Details for Arabidopsis Locus AT2G40610

Position : Chr2 ( 5`- 16948863 .. 16950557 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT2G40610

Protein [Map View]
MYTPSYLKYSIISIISVLFLQGTHGDDGGWQGGHATFYGGEDASGTMGGACGYGNLYGQGYGTNTAALSTALFNNGLTCG
ACYEMKCNDDPRWCLGSTITVTATNFCPPNPGLSNDNGGWCNPPLQHFDLAEPAFLQIAQYRAGIVPVSFRRVPCMKKGG
IRFTINGHSYFNLVLISNVGGAGDVHAVSIKGSKTQSWQAMSRNWGQNWQSNSYMNDQSLSFQVTTSDGRTLVSNDVAPS
NWQFGQTYQGGQF*

DNA
ATGTACACTCCATCATACTTAAAATATTCAATAATCTCAATTATATCCGTATTATTCCTCCAAGGAACTCATGGAGACGA
CGGAGGTTGGCAAGGTGGTCACGCCACGTTTTACGGCGGCGAAGATGCTTCCGGCACCATGGGCGGAGCTTGTGGCTATG
GAAATTTGTATGGCCAAGGTTACGGGACGAACACGGCGGCTTTAAGTACGGCTCTATTCAACAACGGACTCACGTGTGGC
GCGTGCTATGAGATGAAGTGTAACGATGACCCGAGGTGGTGTCTCGGGTCAACCATCACCGTCACAGCTACAAACTTTTG
CCCACCTAACCCTGGCCTCTCCAACGATAATGGAGGTTGGTGCAATCCTCCTCTTCAGCATTTCGACCTCGCCGAGCCAG
CTTTTCTTCAGATCGCTCAGTATCGTGCCGGCATTGTTCCTGTCTCTTTCCGAAGAGTACCATGTATGAAGAAAGGAGGA
ATAAGGTTTACGATCAACGGACACTCATACTTCAACCTCGTTCTGATCTCCAACGTAGGAGGAGCAGGAGACGTACACGC
CGTCTCAATCAAAGGCTCAAAAACACAGTCGTGGCAAGCGATGTCTAGAAACTGGGGACAAAACTGGCAGAGCAATTCAT
ACATGAACGACCAAAGCCTTTCCTTCCAGGTAACGACCAGCGATGGTCGCACACTCGTTAGCAACGACGTGGCTCCTTCT
AATTGGCAGTTCGGACAAACCTACCAAGGTGGTCAGTTCTGA