Details for Arabidopsis Locus AT2G40520

Position : Chr2 ( 5`- 16922587 .. 16925914 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT2G40520

Protein [Map View]
MADHKGKVPVSLSASSSSLSLSPKTTPIEAEVWLIAEARAQEILCAIQPNYLAERSRNKIISNLQTLLWERLGIEVYLFG
SMPLKTYLPDGDIDLTVLTHHASEEDCARAVCCVLEAEMGNSDLQVTGVQYVQAKVKVIKCSIRDVAFDISFNQLAGLGA
LCFLEQVDKAFGRDHLFKKSIILVKAWCFYESRILGANSGLISTYALAILVLNIVNMSYSSLSGPLAVLYKFINYYGSFD
WKNYCVTVTGPVPISSLPDITETGNHEVFLDEKFFRECMELYSGETGVVEASRKYFPVKYYNILDPLKHSNNLGRSVTKG
NMVRLRNCFMLGVQKLRDVLTLPGENVGWKLEKFFNVSLERNGKGQRQDVEEPVVAFGTGAADYSQLKGDFDRYRNNLIY
GKWFHGESLHNWLPPSLDTTSWANISFYMSRVRNGFNGRNQEGPTSMPNIKQSPNNRRSNGTGTYIPGMSKQSNTAGCSS
SKPSTVKSLPSASETQESKKNP*

DNA
ATGGCTGATCATAAAGGAAAGGTTCCAGTCTCTTTATCTGCATCCTCTTCATCGTTGTCTCTGTCTCCAAAAACAACGCC
AATAGAGGCGGAAGTGTGGTTGATTGCTGAGGCAAGGGCTCAGGAGATACTATGTGCCATCCAACCTAACTATCTTGCAG
AAAGAAGTAGGAATAAGATCATCAGTAATCTCCAGACTCTTCTGTGGGAACGTCTTGGAATTGAGGTGTATTTATTTGGT
TCAATGCCATTAAAAACCTATCTCCCAGATGGAGATATTGATCTGACAGTTCTAACTCATCATGCTTCGGAGGAGGACTG
TGCTAGAGCAGTGTGTTGTGTGCTTGAAGCTGAAATGGGAAATTCAGATCTCCAAGTAACTGGTGTTCAGTATGTCCAAG
CAAAGGTCAAAGTCATAAAGTGCTCTATCAGGGACGTTGCTTTCGATATCTCCTTCAATCAATTGGCGGGACTAGGCGCT
TTATGTTTTCTGGAGCAGGTTGACAAAGCTTTTGGTAGAGACCATCTGTTCAAAAAAAGCATCATTTTGGTTAAGGCCTG
GTGTTTTTATGAAAGCCGTATTCTCGGTGCCAACTCTGGATTGATTTCGACATATGCATTGGCTATACTCGTCTTGAACA
TCGTCAACATGTCTTATTCATCACTGTCTGGCCCTTTAGCTGTTCTGTATAAGTTCATAAATTACTATGGATCATTTGAT
TGGAAGAATTACTGTGTCACGGTCACTGGTCCGGTCCCGATATCATCTCTTCCAGATATTACTGAAACCGGAAATCATGA
AGTGTTCCTAGATGAGAAGTTCTTCAGAGAATGCATGGAGTTATATTCTGGGGAAACTGGAGTTGTTGAAGCCAGCAGGA
AATATTTTCCTGTAAAATATTACAACATACTGGATCCTCTGAAACACAGTAACAACCTTGGACGTAGTGTGACAAAAGGA
AATATGGTACGTTTAAGAAATTGTTTTATGCTGGGAGTTCAGAAACTCAGAGATGTGCTTACACTGCCTGGAGAGAACGT
GGGTTGGAAACTGGAGAAGTTCTTTAATGTTTCACTGGAGAGGAACGGTAAGGGACAAAGACAAGACGTAGAGGAGCCTG
TCGTCGCGTTTGGCACTGGAGCAGCAGACTACTCTCAACTTAAAGGAGATTTTGACAGATACCGCAATAATCTTATATAC
GGGAAGTGGTTTCACGGTGAGAGCCTGCATAACTGGCTCCCTCCGAGTCTAGACACAACTTCCTGGGCAAATATCAGCTT
CTATATGAGCAGGGTAAGGAATGGTTTCAATGGGAGGAATCAGGAGGGACCAACATCCATGCCAAATATCAAACAGTCAC
CAAACAATCGGAGATCAAACGGAACAGGCACTTACATTCCTGGAATGAGTAAACAATCTAACACCGCTGGGTGCAGTAGC
AGCAAACCGAGCACGGTGAAGTCATTACCTTCAGCATCTGAGACTCAAGAGTCCAAAAAGAATCCTTGA