Details for Arabidopsis Locus AT2G40475

Position : Chr2 ( 5`- 16906911 .. 16908128 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT2G40475

Protein [Map View]
MKTMSEDDSNGVISSKIIVKESSQVNSSSRIYYYGGASVPFLWETRPGTPKHALFSESLRLPPLTPPPSYYSSSSSSGNK
LSKARTIKQTRFVKTLLSRHVSRPSFSWSSASSSSSSSYSSSSPPSKVEHRPRKCYSCSRSYVKEDDEEEIVSSSPTSTL
CYKRGFSSSMGSMKRALCSVLSHGSSRKDLRLM*

DNA
ATGAAGACAATGTCAGAAGACGACTCTAATGGAGTCATATCTTCAAAGATAATCGTCAAGGAGAGCTCTCAGGTCAATTC
ATCGTCAAGAATCTATTACTACGGCGGAGCCTCCGTGCCTTTTTTATGGGAGACACGACCAGGGACACCAAAACATGCTC
TTTTCTCTGAATCATTACGTCTTCCTCCATTAACGCCACCCCCTTCGTATTACTCATCATCTTCCTCCTCCGGGAACAAA
CTGAGTAAAGCGAGAACGATTAAACAAACTCGATTCGTGAAGACTCTGTTGTCACGTCACGTGTCGCGTCCTTCGTTTTC
TTGGTCGTCTGCGTCTTCTTCTTCTTCCTCTTCGTACTCTTCCTCGTCTCCTCCATCTAAAGTAGAGCATCGTCCGAGAA
AATGTTATTCTTGTTCGAGATCGTACGTTAAGGAAGACGACGAGGAAGAGATTGTGTCGTCGTCTCCAACGTCGACGTTG
TGTTATAAAAGAGGGTTTAGTTCATCTATGGGGAGTATGAAGAGAGCTTTGTGTTCTGTTCTTAGCCATGGATCTAGTCG
TAAAGATCTTAGATTGATGTAA