Details for Arabidopsis Locus AT2G40460

Position : Chr2 ( 5`- 16896907 .. 16901280 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT2G40460

Protein [Map View]
MEAAKVYTQDGTVDLQGRPVLASKTGRWRACSFLLGYEAFERMAFYGIASNLVNYLTKRLHEDTISSVRNVNNWSGAVWI
TPIAGAYIADSYIGRFWTFTASSLIYVLGMILLTMAVTVKSLRPTCENGVCNKASSLQVTFFYISLYTIAIGAGGTKPNI
STFGADQFDSYSIEEKKQKVSFFNWWMFSSFLGALFATLGLVYIQENLGWGLGYGIPTVGLLVSLVVFYIGTPFYRHKVI
KTDNLAKDLVQVPIAAFKNRKLQCPDDHLELYELDSHYYKSNGKHQVHHTPVFRFLDKAAIKTSSRVPCTVTKVEVAKRV
LGLIFIWLVTLIPSTLWAQVNTLFVKQGTTLDRKIGSNFQIPAASLGSFVTLSMLLSVPMYDQSFVPFMRKKTGNPRGIT
LLQRLGVGFAIQIVAIAIASAVEVKRMRVIKEFHITSPTQVVPMSIFWLLPQYSLLGIGDVFNAIGLLEFFYDQSPEEMQ
SLGTTFFTSGIGLGNFLNSFLVTMIDKITSKGGGKSWIGNNLNDSRLDYYYGFLVVISIVNMGLFVWAASKYVYKSDDDT
KEFSGGGCVQMEAKALDTSPLSI*

DNA
ATGGAGGCTGCAAAAGTTTACACACAAGATGGCACCGTCGACCTCCAAGGCCGTCCCGTCCTCGCCTCCAAGACCGGTCG
TTGGAGAGCTTGCTCTTTCCTCCTCGGGTATGAAGCGTTTGAGAGGATGGCGTTTTATGGAATAGCGTCGAACTTAGTGA
ATTATTTGACTAAAAGACTTCACGAAGATACGATCTCTTCGGTTAGAAATGTGAATAATTGGTCCGGTGCGGTTTGGATC
ACTCCCATAGCCGGAGCTTACATCGCTGACTCATACATCGGTCGCTTCTGGACTTTTACTGCCTCCTCTCTCATCTACGT
CCTGGGGATGATTCTCTTGACAATGGCGGTAACAGTAAAATCCCTAAGACCGACATGCGAAAACGGGGTATGCAACAAGG
CCTCCTCGTTACAAGTAACATTTTTCTACATATCCCTCTATACCATAGCTATTGGAGCCGGTGGAACAAAACCTAACATT
TCCACATTTGGAGCGGACCAATTCGACAGTTATAGCATTGAAGAAAAAAAGCAAAAGGTTTCATTCTTCAATTGGTGGAT
GTTTAGCTCTTTCTTAGGCGCGTTGTTTGCGACATTGGGGCTCGTCTACATCCAAGAGAATCTCGGATGGGGTTTAGGTT
ATGGCATCCCTACCGTAGGACTCTTGGTTTCTCTCGTTGTGTTCTATATTGGAACACCATTTTACAGGCATAAGGTTATC
AAAACAGACAATTTGGCGAAAGATTTGGTTCAAGTTCCTATCGCGGCATTCAAAAACCGAAAGCTTCAGTGTCCTGATGA
CCACTTGGAGCTTTATGAGCTTGACTCTCATTATTACAAAAGCAATGGTAAGCATCAAGTTCATCACACGCCCGTCTTCA
GGTTCTTGGATAAAGCGGCCATTAAGACAAGTTCAAGAGTGCCATGTACGGTGACAAAAGTGGAAGTGGCAAAGCGTGTG
CTAGGACTTATCTTTATATGGCTTGTCACTTTGATCCCAAGCACCTTGTGGGCACAAGTCAACACTCTCTTCGTCAAACA
AGGGACCACGCTGGACCGAAAAATTGGATCCAACTTCCAGATCCCCGCGGCTTCATTGGGAAGCTTTGTTACGCTCTCCA
TGCTTCTCTCTGTGCCCATGTACGACCAATCCTTTGTTCCCTTCATGCGCAAGAAAACCGGAAACCCTAGAGGGATTACT
TTACTCCAAAGACTAGGGGTAGGGTTTGCGATACAAATTGTTGCAATCGCGATTGCTTCGGCTGTGGAGGTCAAGAGGAT
GCGCGTGATAAAGGAATTTCACATAACTAGTCCGACACAAGTTGTGCCTATGAGCATTTTCTGGTTGCTCCCTCAGTACT
CTCTTCTAGGCATTGGGGATGTGTTTAACGCAATTGGTTTGCTTGAGTTTTTCTATGATCAGTCACCTGAGGAGATGCAG
AGCCTTGGAACAACGTTTTTCACGAGTGGAATCGGTCTTGGGAATTTCTTGAACAGCTTTTTGGTGACAATGATTGATAA
GATCACGAGTAAAGGTGGAGGGAAGAGTTGGATTGGGAATAATTTGAATGATTCGAGGCTTGATTACTATTATGGATTTC
TAGTGGTGATTTCGATAGTGAACATGGGACTTTTCGTGTGGGCAGCGAGTAAGTATGTTTACAAGAGTGATGATGACACC
AAGGAGTTTAGTGGAGGAGGATGTGTTCAAATGGAGGCCAAAGCCTTAGACACATCTCCTCTTAGTATCTAA