Details for Arabidopsis Locus AT2G40380

Position : Chr2 ( 5`- 16864495 .. 16865442 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT2G40380

Protein [Map View]
MSSSPAILPVTNQQAATQSQPPINSHAFRTFLSRLSSSLRESLSQRRPWLELVDRSSFARPDSLTDSFSRIRKNLAYFKV
NYSAIVSLVLAFSLLSHPFSLLVLLSLLGSWMFLYLFRSSDQPLVLFGRSFSDRETLLGLVLTTIVVVFMTSVGSLLTSA
LTIGIAIVCLHGAFRVPDDLFLDEQEPANAGLLSFIGNSAATSAAASVVAGRV*

DNA
ATGTCTTCTTCTCCGGCGATTCTTCCCGTCACCAACCAGCAAGCAGCCACTCAATCTCAACCTCCAATCAATTCTCACGC
CTTCCGTACTTTCCTCTCACGCCTCTCGTCCTCTCTCCGCGAAAGCCTCTCTCAACGCCGTCCATGGCTAGAACTCGTAG
ATCGGAGCTCCTTCGCTAGACCTGACTCTCTCACCGATTCCTTCTCCCGGATCCGTAAGAATCTCGCTTACTTCAAAGTC
AATTACTCCGCAATTGTCTCGTTAGTCCTTGCTTTCTCCCTCCTCTCGCATCCATTCTCGCTTCTCGTCCTCCTCTCTCT
CTTAGGCTCCTGGATGTTTCTCTACCTCTTCCGATCTTCAGATCAGCCTTTGGTTCTCTTTGGTCGTAGTTTCTCAGATC
GTGAGACTTTGCTTGGTCTTGTTTTGACTACGATTGTGGTTGTGTTTATGACGAGTGTTGGATCTTTGTTAACATCGGCG
TTAACGATTGGAATCGCGATTGTTTGCTTACATGGTGCGTTTAGGGTTCCTGATGATTTGTTCTTGGATGAACAAGAGCC
TGCTAATGCTGGTTTACTCTCGTTCATTGGTAATTCTGCTGCTACTTCTGCTGCTGCTTCTGTTGTTGCAGGACGAGTTT
GA