Details for Arabidopsis Locus AT2G40370

Position : Chr2 ( 5`- 16858166 .. 16860606 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT2G40370

Protein [Map View]
MDVTKSLLCFISFVAFLLFSSVAEANKAHHHEFIIQATKVKRLCETHNSITVNGMFPGPMLVVNNGDTLVVKVINRARYN
ITIHWHGVRQMRTGWADGPEFVTQCPIRPGSSYTYRFTIQGQEGTLWWHAHSSWLRATVYGSLLVFPPAGSSYPFTKPHR
NVPLLLGEWWDANPVDVLRESIRTGGAPNNSDAYTINGQPGDLYKCSSQDTTVVPINVGETILLRVINSALNQPLFFTVA
NHKLTVVGADASYLKPFTTNVIVLGPGQTTDVLITGDQPPNRYYMAARAYQSAQNAPFGNTTTTAILQYKSAPCCGVGGG
SGTKKGNSFKPIMPILPAYNDTNTVTRFSQSFRSLRRAEVPTEIDENLFVTIGLGLNNCPKNFRSRRCQGPNGTRFTASM
NNVSFALPSNYSLLQAHHHGIPGVFTTDFPAKPPVKFDYTGNNISRSLYQPDRGTKLYKLKYGSRVQIVLQDTGIVTPEN
HPIHLHGYDFYIIAEGFGNFNPKKDTAKFNLEDPPLRNTVGVPVNGWAVIRFIADNPGVWIMHCHLDAHISWGLAMAFLV
ENGNGVLQTIEQPPHDLPVC*

DNA
ATGGATGTCACCAAGAGCCTCCTCTGCTTCATCTCTTTCGTCGCCTTTCTTCTCTTCTCCTCCGTGGCAGAAGCCAACAA
AGCACACCACCACGAGTTCATAATACAAGCGACAAAGGTGAAGAGACTATGTGAAACACACAACAGTATTACAGTCAATG
GAATGTTTCCCGGTCCAATGCTTGTAGTCAACAACGGTGACACTCTCGTCGTCAAAGTTATCAACCGGGCCCGGTACAAC
ATCACAATCCACTGGCACGGTGTGAGGCAGATGCGAACCGGTTGGGCTGACGGACCGGAATTTGTGACCCAATGCCCAAT
CAGACCGGGATCAAGTTACACGTACCGGTTTACAATTCAAGGACAGGAAGGTACACTTTGGTGGCATGCTCATAGTTCGT
GGCTTAGAGCAACTGTCTACGGTTCACTTCTCGTCTTTCCTCCTGCTGGTTCGTCTTACCCATTCACAAAACCCCACCGC
AACGTCCCTCTCCTTCTTGGTGAATGGTGGGACGCAAATCCGGTTGATGTGTTGAGAGAATCTATACGAACCGGAGGAGC
TCCGAATAACTCAGACGCTTACACCATCAATGGTCAACCTGGCGATCTCTATAAATGCTCTTCTCAAGATACGACAGTAG
TACCAATAAATGTTGGTGAGACTATACTACTACGAGTAATAAACTCAGCATTAAACCAACCGTTATTCTTCACGGTGGCT
AATCACAAACTCACGGTGGTCGGAGCTGACGCGTCATACCTAAAACCCTTCACCACTAACGTGATAGTTCTTGGCCCGGG
ACAAACCACAGATGTCCTCATAACCGGTGACCAACCACCAAATCGCTACTACATGGCCGCAAGAGCTTACCAAAGCGCCC
AAAACGCACCGTTTGGAAACACAACCACAACAGCAATCCTTCAATACAAATCCGCCCCTTGTTGCGGTGTAGGCGGCGGA
AGTGGAACCAAGAAGGGTAATTCCTTCAAACCGATCATGCCTATCCTCCCTGCCTACAACGACACAAACACCGTCACACG
TTTCAGCCAAAGCTTCCGGTCACTTAGACGAGCTGAGGTTCCGACAGAAATCGACGAGAATCTCTTCGTAACCATCGGAC
TCGGTCTCAACAACTGTCCTAAGAACTTCAGATCAAGAAGATGTCAAGGTCCTAACGGCACACGTTTCACTGCATCGATG
AACAACGTTTCATTTGCTCTTCCAAGTAACTACTCACTCCTTCAAGCTCACCACCATGGGATCCCCGGAGTCTTCACAAC
CGATTTTCCGGCGAAGCCTCCGGTGAAATTTGATTACACTGGTAACAACATAAGCCGATCTCTCTACCAACCTGATAGAG
GGACTAAGCTATACAAACTCAAGTATGGATCAAGGGTTCAGATTGTTCTTCAAGACACAGGTATAGTAACTCCCGAAAAC
CATCCCATTCATCTACACGGCTACGATTTCTACATTATCGCCGAGGGTTTCGGTAACTTCAATCCCAAGAAAGATACCGC
GAAATTCAATCTTGAAGACCCGCCTCTCAGAAATACTGTCGGTGTACCTGTTAATGGTTGGGCCGTCATCAGATTCATCG
CAGACAACCCTGGGGTCTGGATAATGCATTGTCATCTAGATGCACACATATCGTGGGGACTAGCCATGGCTTTTTTGGTT
GAGAATGGAAATGGAGTTTTGCAGACAATAGAACAGCCTCCTCATGATTTGCCCGTTTGTTAG