Details for Arabidopsis Locus AT2G37900

Position : Chr2 ( 5`- 15864396 .. 15866408 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT2G37900

Protein [Map View]
MEHKNIGAEVLQDTYDDQQKWVLDSSLDSRGRVPLRARTGAWRAALFIIAIEFSERLSYFGLATNLVVYLTTILNQDLKM
AIRNVNYWSGVTTLMPLLGGFIADAYLGRYATVLVATTIYLMGLVLLTMSWFIPGLKPCHQEVCVEPRKAHEVAFFIAIY
LISIGTGGHKPSLESFGADQFDDDHVEERKMKMSFFNWWNVSLCAGILTAVTAVAYIEDRVGWGVAGIILTVVMAISLII
FFIGKPFYRYRTPSGSPLTPILQVFVAAIAKRNLPYPSDPSLLHEVSKTEFTSGRLLCHTEHLKFLDKAAIIEDKNPLAL
EKQSPWRLLTLTKVEETKLIINVIPIWFSTLAFGICATQASTFFIKQAITMDRHIGGFTVPPASMFTLTALTLIISLTVY
EKLLVPLLRSITRNQRGINILQRIGTGMIFSLITMIIAALVEKQRLDRTNNNKPMSVIWLAPQFMVIGFADAFTLVGLQE
YFYHQVPDSMRSLGIAFYLSVIGAASFLNNLLITAVDTLAENFSGKSWFGKDLNSSRLDRFYWFLAGVIAANICVFVIVA
KRCPYKSVQPSQGLS*

DNA
ATGGAGCATAAGAATATTGGTGCAGAAGTACTTCAAGATACGTACGATGATCAACAGAAATGGGTTCTTGATTCTTCTCT
TGATAGCAGAGGACGTGTTCCTCTTCGGGCTCGAACTGGCGCTTGGAGAGCTGCACTCTTCATCATCGCGATCGAGTTCA
GCGAGAGATTGAGTTACTTCGGGTTAGCTACAAACTTGGTCGTCTACCTAACAACAATTCTAAACCAAGATCTCAAGATG
GCTATAAGAAATGTGAACTACTGGTCAGGTGTCACTACTTTGATGCCTCTTCTTGGAGGCTTTATAGCCGATGCATATCT
AGGCCGTTATGCTACTGTCTTGGTTGCAACCACCATTTATCTTATGGGTTTGGTCCTTTTAACAATGTCCTGGTTCATAC
CAGGCTTAAAACCTTGTCACCAAGAAGTGTGCGTTGAACCTAGAAAAGCACACGAAGTAGCCTTCTTCATTGCCATTTAC
TTGATCTCCATAGGGACTGGAGGTCATAAGCCTTCCCTTGAAAGCTTTGGTGCTGACCAATTCGACGATGACCATGTTGA
AGAAAGAAAGATGAAAATGTCTTTCTTTAACTGGTGGAACGTTAGTCTATGTGCTGGTATTCTAACGGCCGTGACTGCTG
TTGCCTATATCGAAGACCGGGTTGGTTGGGGCGTTGCTGGCATCATACTAACTGTAGTCATGGCTATATCACTCATCATC
TTCTTCATTGGAAAACCATTCTATCGTTACCGGACACCTTCTGGTAGCCCTTTGACACCAATCTTGCAAGTCTTTGTTGC
CGCCATTGCCAAAAGAAATCTACCTTATCCTTCTGATCCTTCTCTGCTTCATGAAGTGTCCAAGACAGAGTTTACTAGTG
GCCGGCTTCTCTGTCACACAGAGCATCTTAAATTTCTTGACAAGGCAGCAATTATCGAAGACAAAAATCCTCTGGCCCTC
GAGAAACAGAGTCCATGGAGACTTCTAACGTTGACAAAAGTCGAGGAAACGAAGCTGATCATCAACGTGATTCCAATATG
GTTCTCCACGTTGGCCTTTGGCATATGTGCAACACAAGCTTCGACGTTTTTCATCAAACAAGCAATAACCATGGACAGAC
ACATCGGTGGCTTCACAGTTCCTCCAGCTTCCATGTTTACACTTACCGCCCTCACATTGATCATCTCACTCACTGTCTAT
GAGAAACTCCTCGTTCCCTTGCTAAGAAGCATCACACGGAATCAAAGAGGCATCAACATTCTCCAAAGAATCGGGACCGG
TATGATTTTCTCCCTCATCACCATGATCATTGCAGCTCTAGTTGAGAAACAACGATTGGACCGTACCAACAACAACAAAC
CCATGAGTGTGATATGGCTAGCTCCTCAGTTCATGGTCATTGGCTTTGCGGACGCTTTCACACTAGTTGGACTCCAAGAG
TACTTTTACCACCAAGTCCCTGACTCCATGAGAAGCTTAGGTATAGCGTTTTACCTAAGCGTGATAGGTGCGGCTAGCTT
CCTTAACAATCTCCTGATCACAGCCGTTGATACTCTCGCGGAGAATTTCTCGGGGAAGAGTTGGTTCGGAAAGGACCTAA
ACAGCAGCCGCTTGGACCGGTTCTACTGGTTTCTTGCTGGTGTTATCGCTGCCAATATATGTGTCTTTGTGATTGTGGCA
AAGAGATGTCCTTACAAAAGTGTGCAGCCAAGCCAAGGGCTCTCCTGA