Details for Arabidopsis Locus AT2G37640

Position : Chr2 ( 5`- 15787705 .. 15789853 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT2G37640

Protein [Map View]
MTATAFRVGLWLAVTASFLLTATNAKIPGVYSGGPWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFN
NGFSCGACFEIKCTDDPRWCVPGNPSILVTATNFCPPNFAQPSDDGGWCNPPREHFDLAMPMFLKIGLYRAGIVPVSYRR
VPCRKIGGIRFTVNGFRYFNLVLVTNVAGAGDINGVSVKGSKTDWVRMSRNWGQNWQSNAVLIGQSLSFRVTASDRRSST
SWNVAPATWQFGQTFSGKNFRV*

DNA
ATGACGGCGACTGCGTTTAGGGTCGGCTTGTGGTTGGCCGTTACGGCTTCCTTTCTCTTAACCGCAACAAACGCCAAAAT
CCCCGGCGTTTACAGTGGCGGACCGTGGCAGAATGCACACGCCACTTTCTACGGTGGCAGTGACGCCTCCGGCACAATGG
GCGGCGCGTGTGGGTACGGGAACTTGTACAGCCAAGGATACGGTGTGAACACGGCGGCGTTGAGCACTGCTTTGTTCAAC
AACGGATTCAGCTGTGGTGCTTGTTTTGAGATTAAGTGTACTGATGATCCGAGATGGTGTGTTCCGGGAAATCCATCTAT
TCTTGTGACGGCGACGAACTTTTGTCCGCCGAATTTTGCTCAGCCGAGTGACGACGGAGGGTGGTGCAATCCGCCGCGCG
AGCATTTTGATCTCGCCATGCCTATGTTCCTCAAGATCGGTCTATACCGTGCAGGCATTGTCCCCGTCTCCTATCGCAGG
GTACCTTGTCGGAAGATAGGAGGGATAAGATTCACAGTAAACGGATTCAGATACTTCAATCTTGTTCTGGTAACTAACGT
TGCCGGCGCCGGAGATATTAACGGAGTTAGCGTAAAGGGATCAAAGACAGATTGGGTGAGGATGAGTCGGAACTGGGGAC
AGAACTGGCAATCCAACGCCGTTCTCATCGGCCAATCACTCTCTTTCCGAGTCACCGCCTCTGACCGACGTTCTTCTACC
TCATGGAACGTTGCTCCTGCCACGTGGCAGTTTGGTCAGACTTTCTCCGGCAAAAACTTTCGAGTCTGA