Details for Arabidopsis Locus AT2G17930

Position : Chr2 ( 5`- 7784288 .. 7802230 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT2G17930

Protein [Map View]
MSPIQNFEQHSRRLVDLDLPIPTRLEMVVEVRDSLEIAHTAEYLNFLKCYFPAFSVILLQITKPQFIDNPEHKLRNIVVE
ILNRLPHSEVLRPFVQDLLKVAMQVLTADNEENGLICIRIIFDLLRNFRPTLENEVQPFLDFVCKIYSIFRFTVSHFFDN
VKMEEVKPMEMPTSSDQSLTPTPPIGNVQLNPSTRSFKIITESPLVVMFLFQLYSRLVQTNIPHLLPLMVAAISVPGPEN
VPSHLKPQFIELKGAQVKTVSFLTYLLKSCAEYIRPHEESICKSIVNLLVTCSDSASIRKELLVSLKHVLGTDFKRGLFP
LIDTLLDERVLVGTGRACFESLRPLAYSLLAEIVHHVRGDLSLAQLSRIIYLFSRNMHDSTLSLSIHTTCARLMLNLVEP
IFEKGVDQQSMDEARILLGRILDAFVGKFSTFKRTIPQLLEEGEVGKDRVTLRSKLELPVQAVLNLQVPVEHSKEVNDCK
NLIKTLVMGMKTIIWSITHAHLPRPQGMNPQALVSQSSAPQGFKGMREDEVWKASGVLKSGVHCLALFKEKDEEKEMLNL
FSQILAIMEPRDLMDMFSLCMPELFESMINNNQLVQIFAALLQAPKVYKPFADVLINLLVSSKLDVLKNPDSAATKLVLH
LFRCIFGAVTKTPSDFERILQHHVPVIMEVCMKNATEVEKPLGYMQLLRTVFRGLAGCKYELLLRDLIPMLLPCLNILLT
MLEGPAGEDMKDLLLELCLTLPARLSSLLPYLPRLMKPLVFCLRGSDELVSLGLRTLEFWVDSLNPDFLEPSMANVMSEV
ILALWSHLRPVPYPWGKKALQILGKLGGRNRRFLKEPLTLECKDNPEHGLRLVLTFEPSTPFLVPLDKFINLAVAAVIQR
NHGMDIYYRKQALKFLRVCLLSQLNLPGCVTDVGQTPRQLSTLLRSSVDSSWHRSEAVEIKADLGVKTKTQLMAEKSIFK
TLLITILAASSDPDLSDTDDDFVENICRHFAIILHVDYTSSNASTSTSSLGGSVISTSSRSKSNQSSNLKQLDPLIFLDA
LVDVLADENRLHAKAALNALNVFAETLLFLARVKHADVLMARGGHNASMIVSSPSTNPVYSPHPSVRIPVFEQLLPRLLH
GCYGSTWQAQMGGVMGLGALVGKVNVETLCYFQVKIVRGLVYVLKRLPVYASKEQEETSQVLMQILRVVNNVDEANSEAR
RKSFQDVVEYLATELFNPNASIPVRKNVQNCLALLASRTGSEVTELLEPLYQLLLQPLIMRPLRSKTVDQQVGTVAALNF
CLALRPPLLKVTPELVNFLQEALQIAEADETVWAVKLMNPKVLTSLNRLRTACIELLCTTMAWTDFRTQTHNELRAKIIS
MFFKSLTCRAPEIVAVAKEGLRQVINQQRMPKELLQSSLRPILVNLAHTKNLSMPLLQGLARLLELLSNWFNVTLGGKLL
EHLKKWLEPEKLAQSQKAWKAGEEPKIAAAIIELFHLLPHAASKFLDELVTLTIDLEAALPPGQVYSEINSPYRLPLTKF
LNRYAALAVDYFLSRLSEPKYFRRFMYIIRSDAGQPLREELAKSPQKILSYAFPEISPKPDPTLSTTASTPPATSSGDEN
HISVKLESSNVASTKANIASDAYFQGLYLIKTMVKLIPSWLQSNRSVFDTLVLIWKSPARISRLQNEQELNLVQVKESKW
LVKCFLNYLRHEKSEVNVLFDILSIFLFHSRIDYTFLKEFYIIEVAEGYPPNMKRALLLHFLNLFHSKQLGHDHLVQAMQ
MLILPMLAHAFQNGQTWEVIDPDIVKTIVERLLDPPEEVSAEYDEPLRIELLQLATLLLKYLQSDLVHHRKELIKFGWNH
LKREDSASKQWAFVNVCHFLDAYQAPEKIILQVFVALLRTCQPENKMLVKQALDILMPALPKRLPLGDSRMPIWIRYTKK
ILVEEGHSIPNLIHIFLLVVRHSDLFYSCRAQFVPQMVNSLSRLGLPYNTTAENRRLAIELAGLVVSWERQRQNEMKMVT
DTDGTSQITDEMHTSSGADPKRSTDGSATSEDPSKRVKIEPGLQSICVMSPGGASSIPNVETPGSATQPDEEFKPNAAME
EMIINFLIRVALVIEPKDRETNTMYKQALDLLSQALEVWPSANVKFNYLEKLLSSMPPSQSDPSTALAQGLDVMNKVLEK
QPHLFIRNNINQISQILEPCFKHKMLDAGKSLCSLLKMVFTAFPLDAANTPPDIKLLYQKVNELINKHVNTVTAPQTSGD
DNSFGSISFVLLVIKTLANVHKNFVDSYVLVRILQRLARDLGSAVGSHPRQGQRTDSDSAVTSSRQTADVGAVICNIKSV
LELIDETVMLIADCKRSVTQILNTLLSEKGTDASVLLCILDMIKRWVEDDFSKTGASGLSGSFLTQKDVLTFLNKLSYID
KQHFSSEALEEWDQKYLQLLYGLCADSTKYPLGLRQEVSLKVERHFMLGLRASHPGMRRKFFLLYHESLGKTLFARLQYI
IQIQDWEALSDVFWLKQGLDLLLAILVEDKPISLAPNSARVLPLLPSDNPGIQHQAPANLEGPEEVTSMFDSIVMKHAQF
LSATSKLQVADVVIPLRELAHTDANVAYHLWVLVFPIVWVTLLKEEQVALAKPMISLLSKDYHKKQQGHRPNVVQALLEG
LQLSHPQPRMPSELIKYIGKTYNAWHLALALLESHVMLFMNDSKCAESLAELYRLLNEEDMRFGLWKKRSITAETRAGLS
LVQHGFWQRAQSLFYQAMVKATQGTYNNTVPKAEMCLWEEQWLHCASQLSQWDALVDFGKSIENYEILLDSLWKLPDWAY
LKDHVIPKAQVEETPKLRLVQSYFALHDRNSNGVGDAENTVGKGVDLALEQWWQLPEMSVHARVPLLQQFQQLVEVQESA
RIHVDIANGNKVSGNTAVGGLGNRYADLKDILETWRLRTPNEWDNMTVWYDMLQWRNEMYNVVIDAFKDFATSNSPLHHL
GFRDKAWNVNKLARIARKQGLYDVCVQILEKMYGHSTMEVQEAFVKIREQAKAYLEMKGERASGLNLINSTNLEYFPDKI
KAEIFRLKGDFHLKLNDTESANIAYSNAITLFKNLPKGWISWGSYCDMAYQETQEEIWLEYAVSCFLQGIRFGVSNSRSH
IARVLYLLSFDTANEPVGRVFDKHLDQVPHWVWLSWIPQLLLSLQRTEAPHCKLVLLKIAAVFPQALYYWLRTYLLERRD
AVNKSELGRLVLAQRMQQNATGAGHGGSNLPSENQIHQGAQTSGAGGTHDSGNPHGQESERSTTENNLHPGSDQPMHQSS
SAINDNNENTVRRNGASLAISAAGAFDAAKDIMEALRGKHNNLASELEVLLTEIGSRFVTLPEERLLAVVNALLHRCYKY
PTATTAEVPQPLKKELSGVCRACFSADAVTKHVEFVKEYKQDFERHLDPESTTTFPATLAELTARLKKWKNILQSNVEDR
FPAVLRLEDESRVLRDFNVVDVEIPGQYFADQEVAPDHTVKLDRVGADVPIVRRHGSSFRRLTLIGSDGSQKHFIVQTSL
TPNARSDERILQLFRVMNQMFDKHKESRRRHIGIHTPIIIPVWSQVRMVEDDLMYNTFLEVYENHCARNDREADLPITHF
KEQLNQAISGQISAEAIGDLRLQAYIDITKTLVNDSIFSQYMYKTLMSGSHMWAFKKQFAVQLAVSSFMSFMLQIGGRSP
NKVLFAKNTGKMFQTDFHPAYDANGMIEFNEPVPFRLTRNMQAFFSQFGVEGLLMSSMCSAAQAVISSKQNEHLRYQLAM
FFRDELLSWFGRRPLGVPIPPVGGIATLNPAELKHKVNANVEDVIKRIRGIAPQYFSEEDENTVEPPQSVQRGVNELVEA
ALSPRNLCMMDPTWHPWF*

DNA
ATGAGTCCAATTCAGAATTTCGAGCAACACTCCCGTCGTCTCGTGGATCTTGACCTACCTATTCCAACAAGGCTTGAGAT
GGTGGTGGAGGTCAGGGACAGTCTAGAGATAGCACATACGGCAGAGTACTTGAATTTCTTAAAATGCTACTTCCCAGCAT
TCTCAGTTATTCTTCTACAGATTACTAAACCGCAATTTATCGATAATCCGGAGCACAAACTGCGGAACATTGTGGTTGAG
ATCCTCAATCGTCTTCCACACAGTGAGGTTCTTCGTCCCTTTGTTCAGGACCTCTTGAAGGTTGCAATGCAGGTGCTCAC
CGCAGATAATGAAGAAAACGGTTTGATTTGCATTCGGATAATCTTTGACCTTCTTAGGAATTTTAGGCCCACGCTAGAAA
ACGAGGTTCAACCGTTTTTAGACTTTGTCTGCAAAATCTATTCGATTTTCAGATTCACTGTCAGCCATTTTTTCGATAAT
GTTAAAATGGAAGAAGTGAAGCCTATGGAGATGCCTACGTCTTCTGATCAGTCCCTTACCCCTACCCCACCTATCGGGAA
TGTGCAGCTTAATCCGAGTACTCGGTCATTCAAGATAATCACAGAGAGCCCCCTTGTTGTTATGTTCCTTTTCCAGCTGT
ATAGCCGACTCGTTCAGACCAACATTCCTCATTTACTTCCACTGATGGTTGCTGCTATATCTGTCCCTGGACCTGAGAAT
GTCCCTTCACATTTGAAGCCTCAGTTCATAGAGTTAAAAGGTGCACAGGTTAAGACGGTTTCTTTTTTGACTTATTTGCT
AAAAAGTTGCGCCGAATATATCCGTCCGCATGAAGAAAGCATATGCAAAAGCATTGTAAATTTGCTTGTGACGTGTTCAG
ATTCTGCTTCTATCAGAAAGGAACTCTTAGTCTCATTAAAGCATGTGCTTGGGACGGATTTCAAGAGAGGCTTATTTCCT
CTGATTGACACTCTTTTAGATGAGAGGGTTCTAGTTGGAACTGGGCGAGCATGTTTTGAGTCTTTGAGGCCTTTGGCTTA
CAGCCTACTCGCGGAGATTGTTCACCATGTTCGCGGAGATCTTTCTCTCGCACAGTTATCACGGATTATCTACCTATTTT
CAAGAAACATGCACGACTCTACCCTCTCTCTTAGCATTCATACAACATGTGCCCGACTGATGCTGAATCTGGTAGAACCA
ATATTTGAGAAAGGTGTTGATCAGCAGTCAATGGATGAAGCACGGATTTTACTGGGACGTATCCTGGATGCCTTTGTGGG
GAAATTCAGTACTTTCAAGCGTACTATTCCTCAGCTTTTGGAGGAGGGTGAGGTGGGAAAGGATCGGGTCACTTTGAGGT
CGAAGCTTGAACTTCCTGTCCAGGCAGTTTTGAATTTGCAGGTTCCTGTTGAACATTCCAAAGAAGTGAATGATTGTAAG
AATCTGATCAAGACACTGGTCATGGGAATGAAAACAATAATATGGAGTATTACCCATGCACATTTGCCTCGACCTCAGGG
GATGAACCCTCAAGCTCTTGTTTCACAATCATCTGCTCCGCAGGGTTTTAAAGGAATGAGAGAAGATGAGGTGTGGAAAG
CTTCTGGTGTTTTAAAGAGTGGTGTCCACTGCTTAGCTCTCTTCAAAGAAAAGGATGAGGAAAAGGAAATGCTGAATCTT
TTCTCCCAAATTCTTGCTATTATGGAACCTCGAGATCTAATGGACATGTTCTCGTTATGCATGCCAGAGCTTTTTGAGAG
CATGATTAACAATAACCAACTGGTTCAGATATTTGCCGCACTCCTGCAAGCTCCCAAAGTTTACAAGCCATTTGCAGATG
TTTTGATTAATTTACTAGTTAGCAGCAAACTTGATGTTCTGAAGAATCCAGATTCAGCTGCAACTAAACTAGTTTTGCAT
CTGTTTAGATGCATCTTTGGGGCTGTCACCAAAACACCATCTGATTTTGAAAGAATATTACAGCACCACGTGCCTGTTAT
TATGGAAGTCTGCATGAAGAATGCTACGGAAGTTGAAAAACCTCTTGGTTATATGCAATTGCTCCGCACTGTGTTCAGAG
GTCTTGCTGGATGTAAATATGAGCTGCTTCTGAGAGATTTGATCCCCATGCTGCTACCTTGTCTTAATATTCTTTTGACA
ATGCTAGAGGGTCCAGCTGGGGAGGACATGAAAGATCTTTTGCTAGAGCTTTGTTTGACGCTTCCTGCACGCTTAAGCTC
CTTATTGCCATATCTTCCCCGTCTCATGAAGCCTCTTGTATTCTGTTTGAGGGGAAGCGATGAACTTGTGAGCTTGGGGT
TACGCACCCTTGAATTCTGGGTGGATAGTCTGAATCCTGATTTCCTGGAACCTAGCATGGCGAATGTGATGTCTGAAGTG
ATCTTAGCATTATGGTCCCATTTGAGGCCTGTGCCATATCCTTGGGGTAAAAAAGCCTTACAAATCCTTGGAAAGTTGGG
TGGTCGCAACCGAAGATTTCTGAAAGAGCCACTTACACTTGAATGCAAAGATAACCCAGAGCATGGGCTTCGCTTAGTTC
TGACGTTTGAGCCATCAACACCTTTTCTGGTGCCATTAGACAAATTTATTAATCTTGCAGTAGCAGCAGTTATTCAAAGA
AATCACGGCATGGACATATACTACAGAAAGCAAGCTCTAAAATTTCTCCGTGTATGCTTATTGTCCCAGCTTAATTTGCC
TGGATGTGTCACTGATGTGGGTCAAACGCCCAGGCAATTATCTACTTTGTTACGTTCCTCCGTGGATTCATCTTGGCACA
GGAGTGAAGCAGTGGAAATCAAGGCTGACTTAGGAGTGAAAACAAAGACTCAGTTAATGGCTGAGAAGTCAATCTTCAAG
ACACTGTTGATCACTATACTTGCTGCCAGTTCTGATCCAGATCTCAGTGACACGGACGATGACTTTGTTGAGAACATCTG
CCGGCATTTTGCGATTATTTTGCATGTTGACTATACCTCCTCAAATGCATCAACTAGTACTAGTTCACTCGGTGGTTCTG
TGATTTCAACAAGTTCCAGATCCAAGAGTAATCAATCATCTAATTTAAAGCAGTTAGATCCTTTAATATTTTTGGATGCA
CTGGTCGATGTGCTTGCAGATGAAAACAGGCTCCACGCCAAAGCTGCTCTGAATGCGTTAAATGTGTTTGCTGAAACACT
TTTGTTCCTCGCTCGTGTCAAACATGCTGATGTGTTGATGGCTAGGGGTGGTCACAATGCCTCCATGATTGTCTCGAGTC
CTTCTACAAATCCAGTATATTCACCCCATCCAAGTGTGCGAATACCAGTGTTTGAACAACTTTTGCCTCGACTTTTACAC
GGCTGTTATGGGAGCACATGGCAAGCGCAGATGGGAGGGGTTATGGGGTTAGGTGCATTGGTGGGGAAAGTGAATGTTGA
AACATTATGTTATTTCCAAGTAAAGATTGTTCGTGGTCTGGTTTATGTTTTAAAGAGGCTTCCTGTTTATGCTAGCAAAG
AGCAAGAAGAGACAAGTCAGGTACTTATGCAGATTCTACGTGTGGTTAATAATGTTGACGAAGCAAACAGTGAAGCGCGT
AGAAAAAGCTTTCAAGATGTTGTAGAATATCTTGCCACAGAGTTATTCAATCCTAACGCATCCATCCCCGTGAGGAAAAA
TGTGCAGAACTGCCTTGCACTTTTGGCTAGCCGAACTGGAAGTGAGGTAACTGAGTTGCTTGAGCCTTTATACCAACTAT
TACTACAGCCACTTATAATGCGTCCACTCCGATCAAAGACAGTTGATCAACAGGTTGGAACAGTTGCAGCTCTGAATTTC
TGTTTGGCTCTGAGGCCCCCCCTTCTAAAAGTGACTCCAGAGTTGGTTAATTTTCTGCAAGAAGCATTACAAATTGCTGA
GGCTGATGAAACTGTATGGGCTGTGAAGTTGATGAATCCTAAAGTGCTTACATCATTGAACAGACTTCGAACAGCTTGTA
TTGAGCTTCTCTGCACTACTATGGCGTGGACTGATTTCCGAACGCAAACTCACAATGAACTACGTGCCAAAATAATTTCC
ATGTTCTTCAAGTCTCTAACATGTAGAGCACCAGAAATTGTGGCAGTTGCTAAGGAGGGTTTAAGACAGGTTATCAATCA
ACAACGCATGCCCAAGGAACTTCTTCAGAGTAGCCTCAGGCCAATACTTGTTAATCTGGCACACACAAAGAATCTCAGTA
TGCCTTTACTGCAAGGTCTGGCACGCCTTCTCGAACTTCTGTCAAATTGGTTTAATGTAACGTTAGGAGGAAAGTTACTG
GAGCACCTTAAAAAATGGTTGGAGCCAGAGAAACTTGCCCAGTCCCAGAAAGCATGGAAAGCTGGAGAAGAGCCAAAAAT
AGCGGCTGCTATTATCGAGCTCTTCCACTTACTTCCACATGCTGCATCAAAATTTCTAGATGAACTTGTAACCTTAACCA
TTGATTTAGAAGCAGCTCTTCCTCCTGGGCAAGTGTACAGTGAGATTAATAGCCCATACCGTCTACCGCTTACCAAATTT
TTGAATCGATATGCGGCCCTCGCGGTTGATTATTTCCTTTCTAGATTAAGTGAACCAAAATATTTCCGAAGGTTTATGTA
TATAATCCGATCAGATGCTGGCCAGCCGTTAAGAGAAGAACTTGCAAAGTCTCCACAGAAGATACTGTCATATGCCTTTC
CTGAAATTTCGCCAAAACCTGATCCTACATTGAGCACGACGGCTTCAACTCCTCCTGCTACATCATCTGGAGATGAAAAT
CATATCTCTGTTAAATTAGAGAGTTCTAATGTGGCATCAACAAAGGCTAATATAGCATCCGATGCATACTTTCAGGGGCT
CTATCTCATCAAAACAATGGTGAAACTGATACCCAGCTGGTTGCAGAGTAACCGCAGTGTTTTCGATACCTTGGTTCTCA
TTTGGAAATCACCTGCAAGGATATCTCGTTTGCAGAATGAGCAAGAACTGAATTTAGTTCAGGTGAAAGAGAGCAAATGG
CTTGTCAAGTGCTTCTTAAATTACCTGCGGCATGAAAAATCTGAAGTGAATGTTCTCTTTGATATTCTCTCCATTTTCTT
GTTCCATAGCCGCATTGACTACACCTTTTTGAAGGAATTCTACATTATTGAGGTTGCAGAAGGATACCCGCCCAACATGA
AAAGAGCACTCCTACTGCATTTTCTTAACCTTTTCCATTCCAAACAACTCGGCCATGATCATTTAGTTCAAGCGATGCAA
ATGCTTATTCTTCCAATGCTCGCCCATGCTTTCCAAAACGGCCAAACTTGGGAGGTTATTGACCCTGATATAGTCAAAAC
CATTGTTGAGAGGCTTCTTGATCCACCCGAAGAGGTTTCGGCTGAATATGATGAACCTTTGAGGATTGAACTTTTGCAAT
TAGCAACTTTGCTTCTAAAATATCTTCAGAGTGATTTGGTTCATCATAGAAAAGAGCTCATTAAGTTTGGATGGAATCAT
CTCAAACGGGAAGATAGTGCCAGTAAACAGTGGGCATTTGTTAATGTTTGCCACTTCTTGGATGCTTACCAGGCTCCTGA
GAAAATCATTCTTCAGGTTTTTGTTGCACTTCTTAGGACATGCCAGCCGGAGAATAAGATGCTAGTTAAGCAAGCCCTGG
ATATTCTAATGCCAGCGTTGCCTAAAAGGCTACCTCTTGGAGATTCACGCATGCCAATTTGGATAAGATACACAAAGAAA
ATTTTGGTGGAGGAAGGTCATTCAATTCCAAATTTGATCCACATCTTCCTACTTGTTGTTCGGCATTCAGATCTCTTTTA
CAGCTGTAGAGCACAATTTGTCCCTCAAATGGTGAATTCGTTAAGTCGTCTAGGTTTGCCATATAATACTACTGCAGAGA
ATAGGAGGCTCGCAATTGAACTTGCTGGATTGGTTGTCAGCTGGGAAAGGCAAAGACAGAATGAAATGAAAATGGTCACT
GATACTGATGGAACCAGTCAGATTACTGATGAAATGCATACTTCATCTGGTGCTGATCCTAAGCGTTCAACTGATGGGTC
TGCCACATCAGAAGATCCAAGTAAACGAGTCAAAATCGAACCTGGTCTCCAATCAATCTGTGTAATGTCGCCTGGCGGTG
CATCATCAATCCCCAATGTAGAAACTCCTGGATCTGCTACCCAGCCTGACGAGGAATTCAAGCCAAATGCTGCCATGGAA
GAAATGATCATTAATTTTCTCATAAGAGTAGCGTTGGTAATTGAGCCTAAGGACAGGGAAACCAACACTATGTACAAACA
AGCATTAGATTTGCTTTCACAAGCTTTGGAGGTTTGGCCAAGTGCTAATGTCAAGTTCAACTATTTAGAGAAACTGCTGA
GCAGCATGCCACCGTCTCAGTCGGATCCATCAACAGCACTTGCTCAGGGATTGGATGTCATGAACAAAGTTCTAGAGAAG
CAGCCACATCTTTTCATTAGAAACAACATCAACCAGATCTCGCAGATTCTTGAACCGTGTTTCAAACACAAGATGCTCGA
TGCTGGTAAATCGTTGTGCTCCTTGCTGAAGATGGTGTTCACCGCATTCCCATTGGATGCGGCTAATACACCTCCTGACA
TAAAGCTATTGTACCAGAAAGTCAATGAGCTGATAAACAAACATGTGAATACTGTTACTGCTCCACAAACTTCAGGAGAT
GATAACTCTTTTGGTTCGATTAGCTTTGTACTTCTTGTCATCAAAACCTTGGCCAATGTACATAAAAACTTTGTCGATTC
ATATGTGTTGGTGCGTATCCTTCAGCGCCTTGCACGAGACCTGGGATCAGCAGTGGGTTCTCATCCTAGACAAGGCCAGC
GAACAGATTCAGATTCTGCAGTAACTTCTTCTCGTCAAACTGCTGATGTTGGAGCAGTCATATGTAATATAAAGTCGGTC
TTGGAACTTATTGATGAAACGGTCATGCTTATAGCAGATTGCAAAAGATCTGTTACTCAAATTTTGAACACCTTGCTTTC
CGAAAAGGGTACTGATGCTAGTGTGCTTCTCTGCATACTAGACATGATAAAAAGGTGGGTTGAGGATGATTTCAGCAAAA
CAGGCGCATCTGGTTTGTCTGGTTCTTTCCTTACCCAAAAGGACGTACTTACTTTTCTCAATAAGCTTTCTTATATTGAT
AAGCAACACTTCTCATCTGAGGCTTTGGAAGAGTGGGATCAGAAGTATCTTCAGCTGTTATATGGACTATGTGCTGATTC
AACAAAGTATCCTCTAGGCCTACGGCAAGAAGTCTCTCTGAAAGTTGAAAGACATTTTATGCTTGGTTTACGGGCAAGTC
ATCCTGGGATGAGAAGGAAGTTCTTCTTGTTATATCACGAGTCTCTTGGAAAAACTTTGTTCGCGCGGTTGCAGTATATT
ATTCAAATTCAGGATTGGGAAGCTTTAAGTGATGTTTTTTGGCTTAAACAAGGTCTTGATCTCCTTCTAGCTATCTTAGT
CGAGGACAAGCCAATTAGCCTGGCGCCAAATTCTGCAAGGGTACTACCACTTTTGCCTTCAGATAATCCTGGAATACAAC
ACCAAGCTCCTGCTAACTTAGAGGGTCCCGAAGAAGTTACTTCAATGTTTGACAGCATTGTTATGAAGCATGCACAATTT
CTGAGCGCGACCAGCAAACTTCAGGTGGCTGATGTGGTCATTCCTTTAAGGGAGCTGGCTCACACGGATGCCAATGTTGC
ATATCATCTGTGGGTTTTGGTATTTCCAATTGTATGGGTAACCCTGCTCAAGGAAGAACAAGTAGCATTGGCTAAACCTA
TGATTTCTCTACTATCGAAGGACTACCATAAGAAGCAGCAAGGACACCGGCCAAATGTTGTCCAAGCACTTCTGGAAGGA
CTTCAATTGAGCCACCCTCAACCTAGGATGCCTAGTGAGCTTATCAAATATATTGGAAAAACGTACAATGCATGGCATCT
CGCATTGGCATTGCTAGAGAGCCATGTGATGTTGTTCATGAATGACTCAAAATGTGCTGAGTCTCTTGCTGAGCTTTATC
GTTTGTTAAATGAAGAAGATATGAGATTTGGGTTGTGGAAGAAGAGGTCCATCACCGCTGAAACAAGAGCTGGACTTTCA
TTAGTTCAGCATGGTTTTTGGCAGCGTGCTCAGAGCCTCTTTTACCAGGCAATGGTTAAGGCAACCCAAGGCACGTATAA
CAACACAGTCCCTAAAGCTGAAATGTGTCTGTGGGAGGAGCAGTGGCTTCACTGTGCCAGTCAGCTTAGTCAATGGGATG
CCCTGGTAGATTTTGGCAAAAGCATTGAGAATTATGAAATACTGCTTGATAGTCTTTGGAAATTACCCGATTGGGCATAT
TTGAAAGATCACGTGATACCAAAGGCACAAGTGGAGGAGACTCCAAAGCTTCGTTTGGTTCAATCTTATTTTGCCCTTCA
TGACAGAAATTCAAATGGTGTTGGAGATGCTGAAAACACAGTGGGGAAAGGCGTTGATCTTGCCTTGGAACAGTGGTGGC
AGTTGCCTGAAATGTCTGTTCATGCTAGAGTGCCTCTACTGCAGCAATTCCAACAACTAGTTGAGGTTCAGGAGTCTGCT
AGAATTCATGTTGACATCGCCAATGGGAACAAAGTTTCAGGAAATACTGCGGTTGGTGGACTTGGTAATCGTTATGCAGA
TCTGAAGGATATTCTTGAGACTTGGAGGCTGAGGACTCCAAATGAATGGGACAATATGACAGTCTGGTACGATATGCTAC
AGTGGAGGAATGAAATGTATAATGTTGTTATTGATGCATTTAAGGACTTTGCTACTTCAAATTCTCCACTTCATCACCTT
GGTTTCCGTGACAAAGCATGGAACGTCAATAAGCTTGCCAGGATAGCTAGGAAACAAGGGCTTTATGATGTTTGTGTTCA
GATTCTTGAAAAAATGTATGGACACTCAACAATGGAAGTACAGGAAGCTTTTGTTAAAATTAGAGAGCAAGCAAAAGCTT
ATCTGGAAATGAAGGGAGAGCGTGCTAGTGGTCTTAATCTGATCAATAGCACAAATTTGGAGTATTTTCCAGATAAGATC
AAGGCAGAGATATTTCGTCTGAAGGGGGACTTTCATTTGAAATTAAATGACACTGAAAGTGCTAATATCGCATATTCCAA
TGCAATCACCCTGTTCAAGAATTTACCCAAAGGATGGATAAGCTGGGGAAGCTATTGTGACATGGCATACCAAGAAACAC
AAGAAGAAATTTGGCTTGAATATGCTGTCAGTTGCTTTCTTCAGGGAATAAGATTTGGTGTTTCTAATTCTAGAAGTCAT
ATAGCTCGTGTTCTTTATCTTCTTAGTTTTGATACAGCGAATGAGCCTGTTGGCAGGGTCTTTGATAAACACTTAGACCA
AGTTCCTCACTGGGTGTGGCTTTCTTGGATCCCACAGCTGTTACTTTCCCTGCAAAGAACAGAAGCACCTCATTGCAAAT
TGGTTTTATTGAAAATTGCTGCAGTTTTCCCACAGGCTCTCTATTACTGGTTGCGCACATACTTGCTGGAACGACGTGAT
GCAGTAAATAAATCCGAACTTGGCAGATTAGTTTTGGCTCAAAGAATGCAGCAAAATGCCACTGGTGCAGGTCATGGTGG
AAGCAATTTACCATCAGAAAATCAAATCCATCAAGGCGCTCAAACAAGTGGGGCTGGTGGAACACATGACAGTGGTAACC
CACATGGGCAAGAAAGTGAACGCTCCACTACGGAAAATAATCTCCATCCTGGTAGTGATCAACCTATGCACCAAAGCAGC
TCTGCGATCAATGATAACAATGAAAACACAGTGAGACGGAATGGTGCATCCTTGGCAATCTCTGCTGCGGGTGCATTTGA
CGCTGCCAAGGATATCATGGAAGCTCTTAGGGGTAAACATAACAACTTAGCCAGCGAACTCGAGGTTCTTCTCACGGAAA
TAGGCTCGAGATTTGTTACATTACCGGAAGAAAGACTGCTGGCGGTTGTGAATGCTCTGTTACATCGCTGTTACAAGTAT
CCAACTGCTACCACTGCCGAGGTTCCCCAACCACTCAAAAAAGAGCTGTCGGGTGTCTGCAGAGCTTGTTTCTCGGCAGA
TGCTGTAACCAAGCATGTCGAATTTGTAAAAGAGTACAAACAGGATTTTGAGCGTCACCTTGATCCAGAAAGTACAACTA
CATTCCCTGCCACACTCGCTGAGCTGACCGCTCGACTGAAAAAGTGGAAAAATATTCTTCAGAGCAATGTTGAAGACAGG
TTTCCTGCTGTGTTAAGATTGGAAGATGAGAGCAGGGTTTTGCGTGACTTTAATGTTGTTGATGTGGAGATACCAGGGCA
GTACTTTGCTGACCAGGAAGTAGCACCTGATCATACAGTAAAGTTGGATAGGGTTGGAGCAGACGTTCCTATTGTTCGAA
GGCATGGAAGCAGCTTCAGGCGGTTGACTCTTATTGGCTCAGATGGCTCGCAAAAGCACTTTATAGTCCAGACATCATTG
ACGCCTAATGCTAGAAGTGATGAACGCATCTTGCAGCTTTTCCGTGTAATGAACCAAATGTTTGATAAGCATAAGGAATC
AAGAAGACGGCACATTGGAATCCACACTCCAATCATCATTCCTGTCTGGTCTCAGGTCCGGATGGTTGAGGATGATCTCA
TGTACAACACTTTCCTTGAGGTGTATGAGAATCACTGTGCACGAAATGACCGAGAGGCAGATCTTCCAATTACCCACTTT
AAGGAGCAACTCAATCAAGCTATATCAGGGCAAATATCAGCAGAGGCAATAGGAGATCTTCGTCTGCAGGCATATATTGA
CATCACAAAAACCTTGGTCAATGACAGTATCTTTTCTCAGTACATGTACAAGACGTTGATGAGCGGAAGCCATATGTGGG
CTTTCAAGAAACAATTTGCAGTCCAGCTAGCAGTCTCCAGTTTCATGTCCTTCATGCTACAAATTGGTGGGAGGTCCCCG
AACAAGGTCTTGTTTGCAAAAAACACCGGGAAAATGTTCCAGACAGATTTTCACCCTGCTTATGACGCCAATGGGATGAT
TGAATTTAACGAACCTGTGCCTTTCCGCCTCACAAGGAACATGCAAGCTTTCTTCTCTCAGTTTGGAGTCGAAGGTCTCC
TCATGTCATCCATGTGTTCAGCAGCGCAAGCAGTAATCTCCTCCAAGCAAAACGAACATCTACGGTACCAACTTGCTATG
TTCTTCCGTGATGAATTGTTGTCTTGGTTTGGAAGAAGACCTCTTGGTGTGCCGATTCCTCCTGTTGGAGGAATTGCTAC
TTTGAACCCAGCTGAGCTGAAGCACAAAGTTAACGCCAATGTGGAAGATGTCATTAAACGGATCAGAGGAATAGCCCCAC
AGTACTTTTCCGAAGAGGATGAGAATACGGTGGAGCCGCCGCAGTCAGTGCAAAGAGGAGTGAACGAGTTGGTGGAGGCA
GCCTTGTCGCCTCGCAACTTATGTATGATGGATCCAACATGGCATCCTTGGTTCTAA