Details for Arabidopsis Locus AT2G17880

Position : Chr2 ( 5`- 7766962 .. 7767931 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT2G17880

Protein [Map View]
MLSSSPTFFATPFLSSSSSSSPSFSSTSPPSRISRISPSLSTTTASYTCAEDLPRLRQIPQRFSATASLYEILEIPVGST
SQEIKSAYRRLARICHPDVARNSRDNSSADDFMKIHAAYCTLSDPEKRAVYDRRTLLRSRPLTAGYGSYGGRNWETDQCW
*

DNA
ATGCTTTCTTCTTCCCCAACCTTCTTCGCTACTCCATTTCTCTCTTCTTCTTCTTCTTCTTCTCCGTCGTTCTCTTCTAC
TTCACCACCGTCACGCATTTCCCGGATCTCGCCGTCGCTTTCTACAACCACCGCGTCCTACACCTGCGCCGAAGATCTAC
CGAGATTACGCCAAATCCCGCAGCGATTTTCAGCAACCGCGTCTCTCTACGAGATCCTTGAAATTCCCGTCGGCTCGACG
AGTCAAGAGATCAAATCAGCTTACCGGCGACTAGCCAGGATCTGTCATCCCGATGTAGCGAGAAATAGTCGGGATAACTC
GTCGGCGGACGATTTCATGAAGATCCACGCAGCGTATTGCACGCTTTCGGATCCCGAGAAACGCGCCGTTTATGATCGGA
GGACTCTTCTTCGGAGCCGGCCGTTAACGGCTGGATACGGCAGTTACGGTGGACGGAATTGGGAAACCGATCAGTGCTGG
TAG