Details for Arabidopsis Locus AT2G17870

Position : Chr2 ( 5`- 7763975 .. 7765230 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT2G17870

Protein [Map View]
MAMEDQSAARSIGKVSWFSDGKGYGFITPDDGGEELFVHQSSIVSDGFRSLTLGESVEYEIALGSDGKTKAIEVTAPGGG
SLNKKENSSRGSGGNCFNCGEVGHMAKDCDGGSGGKSFGGGGGRRSGGEGECYMCGDVGHFARDCRQSGGGNSGGGGGGG
RPCYSCGEVGHLAKDCRGGSGGNRYGGGGGRGSGGDGCYMCGGVGHFARDCRQNGGGNVGGGGSTCYTCGGVGHIAKVCT
SKIPSGGGGGGRACYECGGTGHLARDCDRRGSGSSGGGGGSNKCFICGKEGHFARECTSVA*

DNA
ATGGCGATGGAAGATCAATCGGCGGCGAGATCTATCGGAAAAGTTAGTTGGTTTAGCGATGGAAAAGGCTACGGTTTCAT
TACTCCCGATGATGGCGGCGAAGAGCTTTTTGTTCATCAATCCTCAATTGTCTCCGATGGATTCCGTAGCTTGACTCTTG
GTGAATCGGTTGAATACGAAATCGCGCTTGGAAGCGACGGAAAGACTAAGGCCATTGAAGTTACTGCTCCCGGCGGCGGT
TCACTTAATAAGAAGGAAAACAGCTCCCGTGGATCCGGAGGTAATTGTTTTAATTGCGGTGAGGTTGGTCATATGGCTAA
GGATTGTGACGGTGGAAGTGGTGGGAAAAGCTTTGGAGGTGGTGGTGGTCGTAGATCTGGCGGCGAAGGTGAATGTTACA
TGTGTGGTGATGTGGGACACTTCGCTAGGGATTGTAGGCAAAGCGGTGGTGGAAACAGCGGCGGAGGAGGAGGAGGTGGT
CGTCCGTGTTACAGTTGCGGTGAGGTTGGTCATTTGGCAAAGGATTGTCGTGGTGGTTCTGGTGGAAACAGATACGGAGG
AGGTGGTGGTCGTGGATCTGGCGGTGATGGATGCTACATGTGTGGTGGTGTGGGACATTTCGCTAGGGATTGTAGGCAAA
ACGGCGGTGGAAACGTTGGAGGTGGTGGAAGCACTTGTTATACCTGTGGCGGAGTTGGCCACATTGCGAAAGTTTGCACC
AGCAAGATACCTTCTGGTGGTGGTGGTGGTGGTCGTGCTTGTTACGAATGTGGAGGAACTGGCCATTTGGCTCGTGACTG
TGATCGGAGAGGAAGTGGAAGCAGCGGAGGTGGCGGTGGCAGTAACAAGTGCTTCATCTGCGGCAAGGAAGGTCACTTTG
CGAGGGAATGTACTTCGGTTGCTTAA