Details for Arabidopsis Locus AT2G17860

Position : Chr2 ( 5`- 7762257 .. 7763018 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT2G17860

Protein [Map View]
MDLAKVSCFLLAIMFFINGGSSTTFTIVNQCNYTVWPGLLSGAGTAPLPTTGFSLNSFESRLISIPAAWSGRIWGRTLCN
QNEITGIFTCVTGDCGSSQIECSGAGAIPPATLAEFTLNGAENLDFYDVSLVDGYNIPMTIVPYGGAIGVGKCNATGCAA
DLNGLCPEQLKVTVEAAGTGAVACKSACEAFGTPEFCCNGAFGTPDTCQPSEYSVFFKKTCPTAYSYAYDDGTSTFTCSG
ADYVITFCPSPSR*

DNA
ATGGATTTGGCTAAAGTCTCTTGCTTTCTCTTAGCGATTATGTTTTTCATCAATGGTGGTTCCTCCACCACGTTCACCAT
CGTTAACCAGTGTAACTACACCGTCTGGCCGGGACTTCTCTCCGGCGCCGGCACCGCTCCATTACCCACCACTGGTTTCT
CCCTCAACTCCTTTGAGTCACGACTCATCTCCATACCCGCCGCTTGGTCCGGCCGCATATGGGGACGCACGCTCTGCAAC
CAAAACGAAATCACCGGAATATTCACTTGCGTCACCGGCGACTGCGGCTCATCCCAAATCGAATGCTCTGGCGCAGGAGC
AATCCCTCCAGCTACACTAGCCGAATTCACACTCAACGGCGCCGAAAATCTAGATTTCTACGACGTTAGCCTCGTCGATG
GTTACAACATCCCAATGACGATCGTTCCTTACGGCGGAGCTATCGGAGTCGGTAAGTGTAACGCAACGGGTTGCGCGGCG
GATCTCAACGGCTTATGTCCGGAGCAGCTGAAAGTAACGGTTGAAGCGGCTGGAACGGGTGCTGTGGCGTGCAAGAGCGC
TTGTGAGGCGTTTGGAACGCCGGAGTTTTGTTGTAACGGCGCGTTTGGAACGCCGGACACGTGTCAGCCGAGTGAGTACT
CTGTTTTCTTTAAGAAAACTTGTCCGACGGCTTATAGTTACGCTTATGACGACGGCACAAGCACTTTTACTTGCTCCGGT
GCTGATTACGTCATCACTTTCTGTCCTTCTCCTTCAAGGTAA