Details for Arabidopsis Locus AT2G17845

Position : Chr2 ( 5`- 7758846 .. 7759881 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT2G17845

Protein [Map View]
MSFWFRDKSLYVMGISFSTKEHTKRNNMSNHQTVREILLLLYLTCELKDKVVLVTGASSGIGREVCLDLAKAGCKIIAAA
RRVDRLKSLCSEINRFEYSAGIQAEALELDVSSDAATVQKAVKKAWEIFGKIDALINNAGFRGNVKSSLDLSEDEWDKVF
KTNLTGTWLVSKYVCILMRDAKRGGGSVINISSVSWLHRGQVPGGVAYACSKGGVDTMTRMMALELGVYKIRVNSIAPGL
LKSEITQGLMQKEWLKTVIERTVPLKVQQTVDPGLTSLLRYLVHDSSKYISGNTYIVDAGASLVGLPIFSSL*

DNA
ATGTCGTTTTGGTTTAGAGACAAGTCTTTATATGTTATGGGCATATCCTTCTCCACCAAAGAACACACAAAGAGAAACAA
CATGAGTAATCATCAAACTGTGCGTGAGATACTTCTTCTCTTATATCTCACTTGTGAACTTAAAGACAAAGTGGTTCTTG
TGACAGGAGCTTCCTCTGGTATAGGAAGAGAGGTATGTCTTGATCTAGCCAAAGCTGGCTGTAAGATTATCGCAGCAGCT
CGTCGTGTCGATCGTCTCAAATCTCTCTGCTCTGAAATAAATCGCTTCGAATATTCAGCTGGAATTCAAGCTGAAGCTCT
TGAGCTAGACGTTTCATCAGACGCAGCCACCGTTCAAAAAGCGGTTAAGAAAGCTTGGGAAATCTTCGGAAAGATCGATG
CGTTGATCAACAATGCGGGATTTAGAGGCAATGTCAAGTCGAGTTTGGATTTGTCAGAAGACGAGTGGGACAAAGTCTTC
AAGACCAACTTAACCGGAACCTGGTTAGTCTCCAAATACGTATGCATTTTAATGCGCGATGCTAAACGTGGTGGTGGCTC
GGTGATAAACATTTCATCAGTATCCTGGCTCCACCGCGGTCAGGTGCCTGGTGGAGTCGCATACGCTTGTTCTAAAGGCG
GTGTTGACACCATGACAAGGATGATGGCACTTGAGTTAGGTGTTTACAAGATCAGAGTGAATTCGATCGCACCAGGGCTT
TTAAAGTCAGAGATCACACAAGGTCTTATGCAAAAAGAGTGGCTCAAGACCGTTATCGAGAGGACAGTCCCATTAAAGGT
ACAACAGACAGTGGATCCGGGGCTTACTTCTCTCCTACGCTACCTCGTTCACGACTCGTCTAAATATATCTCCGGGAATA
CATACATTGTCGATGCTGGAGCTTCATTGGTCGGTCTGCCCATTTTTTCATCTCTCTAA