Details for Arabidopsis Locus AT2G17830

Position : Chr2 ( 5`- 7754210 .. 7755604 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT2G17830

Protein [Map View]
MAIMSDLPRDLLAEILSRVPLASLRSVRFTCKKWNDLSKDRSFLKKQIVEAKKKQLKSKEFEVIMMRNFRVYLTSVDLHN
DVNPSFTPKGTLTSFSDDANQHQVDNVSSVFHCDGLLLCITKDLNFRLVVWNPYFGQTRWIQPRNSYHIKDIYAIGYDEN
KNHKILRLKDQYYDYDSHPRARICEFELYSFESNSWKVVLDVSPDWYIHSYHRGLSVKGNTYWYATEKHGYVNFLICFDF
TTEKFGPRLPLPFNATESFTYDDVVTLSSVGEEQLALLFQSDATLMMEIWVTSKVDPTEVLWNKLFLAVDHDMIEFDYEL
KFVADAGSFFIDQKKNVVVVFDKDMNEHTHRGMAYIVGKNGYFKRVDIGEEAYTSCFPLVCSYVPSSVQIRQLT*

DNA
ATGGCGATAATGTCAGATCTTCCACGGGATTTGTTAGCAGAGATTCTCAGTAGGGTTCCATTGGCATCTTTAAGATCAGT
GCGGTTCACTTGCAAAAAATGGAACGATTTATCCAAAGATCGGAGCTTTCTCAAGAAACAAATCGTCGAAGCAAAGAAGA
AGCAATTGAAATCGAAGGAGTTTGAGGTGATCATGATGAGGAATTTTAGAGTTTATCTAACGAGCGTCGATCTCCACAAC
GATGTTAATCCATCTTTTACGCCTAAAGGTACACTTACTAGCTTTAGCGATGATGCAAATCAGCATCAAGTCGATAATGT
GTCTAGTGTCTTTCACTGCGATGGTTTACTCTTATGCATCACCAAAGACCTCAACTTTAGGCTTGTGGTTTGGAACCCTT
ATTTTGGGCAAACAAGATGGATCCAACCCAGAAATTCTTACCACATAAAGGACATTTACGCTATTGGGTACGATGAGAAT
AAGAACCACAAAATCCTGAGATTGAAGGATCAGTATTACGATTATGATTCACATCCACGGGCACGGATTTGTGAGTTTGA
ACTCTACAGTTTTGAGTCTAATTCATGGAAGGTTGTTCTTGATGTTAGTCCTGACTGGTATATACACTCTTATCACCGTG
GCTTGTCTGTAAAGGGGAATACTTACTGGTATGCAACAGAGAAGCATGGCTATGTTAATTTCTTGATCTGTTTTGATTTC
ACAACTGAGAAATTTGGACCGCGTTTGCCTCTGCCTTTTAACGCTACCGAGTCTTTTACTTATGATGATGTTGTTACTCT
CTCTAGTGTTGGAGAAGAGCAGCTTGCGCTGTTGTTTCAGAGTGATGCTACATTGATGATGGAGATTTGGGTTACGAGCA
AGGTTGACCCCACAGAGGTTTTGTGGAACAAATTGTTCTTAGCGGTTGATCATGATATGATAGAATTCGACTATGAGTTA
AAGTTTGTGGCAGACGCTGGGAGTTTCTTCATTGACCAGAAGAAGAATGTTGTTGTGGTTTTTGATAAAGATATGAATGA
GCATACCCATCGTGGCATGGCTTACATTGTTGGGAAGAACGGATACTTCAAAAGAGTGGATATTGGGGAAGAAGCATACA
CGAGTTGTTTCCCACTTGTCTGTTCTTATGTTCCAAGCTCAGTGCAAATCAGGCAGCTAACCTGA