Details for Arabidopsis Locus AT2G17820

Position : Chr2 ( 5`- 7742924 .. 7748220 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT2G17820

Protein [Map View]
MRGDSFSMSIENLPDSPMGSRKKKMQIRKVFDKMTEWVTPWRSNLESPREMMILRGDVEQDEFQYASSHCLSSYYSVFVV
RLAIMVMLAILIGLLTVLTWHFTRIYTKQSLQTLAYGLRYELLQRPVLRMWSVLNTTSELTTAQVKLSEYVIKKYDKPTT
QEELVEMYQAMKDVTWALFASAKALNAITINYRNGFVQAFHRDPASSSTFYIFSDLKNYSISGTGPEDVSGWNNKSIHGN
MSAIWYQQQLDPVTGENLGKPLKIPPDDLINIAGISQVPDGEASWHVTVSKYMDSPLLSAALPVFDASNKSIVAVVGVTT
ALYSVGQLMRDLVEVHGGHIYLTSQEGYLLATSTDGPLLKNTSNGPQLMKATDSEEWVIKSGAQWLEKTYGSKRPHVVHA
ENVKLGDQRYYIDSFYLNLKRLPIVGVVIIPRKFIMGKVDERAFKTLIILISASVCIFFIGCVCILILTNGVSKEMKLRA
ELIRQLDARRRAEASSNYKSQFLANMSHELRTPMAAVIGLLDILISDDCLSNEQYATVTQIRKCSTALLRLLNNILDLSK
VESGKLVLEEAEFDLGRELEGLVDMFSVQCINHNVETVLDLSDDMPALVRGDSARLVQIFANLISNSIKFTTTGHIILRG
WCENINSLHDEMSVSVDRRKPWAPMKTKQVQHRNHLQKSCKNANKMVLWFEVDDTGCGIDPSKWDSVFESFEQADPSTTR
THGGTGLGLCIVRNLVNKMGGEIKVVQKNGLGTLMRLYLILSTPDTVDQNIQPDFSKYGLVVMLSMYGSTARMITSKWLR
KHGIATVEASDWNELTQIIRDLLETGSRDNSFDSQHNISDPLRAELSNIVEIKNPVFVIVVDIGVLDLTTNIWKEQLNYL
DRFSNKAKFAWLLKHDTSNTVKTELRRKGHVMMVNKPLYKAKMIQILEAVIKNRKRGLCNDLRNRGNGSDESHDCLEIDP
TQFDTCSSDDSSETSGEKQVDKSVKPSTLHSPVLKNYLIDATTSNDDSTSASMTQKNPEEEDWKDRLYSGIALDGKNQKS
LEGIRILLAEDTPVLQRVATIMLEKMGATVTAVWDGQQAVDSLNYKSINAQAPTEEHKSFEEETANKVTTRETSLRNSSP
YDLILMDCQMPKMDGYEATKAIRRAEIGTELHIPIVALTAHAMSSDEAKCLEVGMDAYLTKPIDRKLMVSTILSLTKPSA
FQTSLSA*

DNA
ATGCGAGGAGATAGCTTCTCAATGAGTATTGAGAATCTTCCTGATTCTCCAATGGGTTCGAGGAAGAAGAAGATGCAGAT
CAGGAAGGTGTTCGATAAAATGACTGAATGGGTTACCCCTTGGAGAAGTAATTTGGAGAGTCCAAGAGAGATGATGATTT
TGCGTGGAGATGTTGAACAAGATGAGTTTCAATACGCTAGTAGTCACTGTTTGTCTTCTTACTACAGTGTCTTTGTTGTT
CGCCTCGCTATAATGGTTATGTTAGCAATTTTGATAGGGCTTTTAACGGTTCTAACATGGCATTTCACAAGGATTTATAC
AAAGCAGTCGCTTCAAACATTAGCGTATGGCCTTAGATACGAGCTTCTTCAGCGTCCAGTCTTACGGATGTGGAGCGTTT
TAAACACCACATCAGAGCTAACAACAGCTCAAGTCAAGTTATCTGAATATGTCATCAAAAAATATGACAAGCCAACAACT
CAAGAAGAACTTGTGGAGATGTATCAAGCAATGAAGGATGTGACATGGGCTCTGTTTGCGAGTGCCAAAGCTCTAAATGC
CATAACCATAAACTACAGAAATGGATTTGTCCAAGCTTTTCACAGAGATCCAGCAAGTAGCAGCACATTCTACATCTTCT
CCGATCTAAAAAACTATTCCATCAGTGGAACAGGGCCTGAAGATGTAAGTGGGTGGAACAACAAGTCAATACACGGGAAC
ATGTCTGCCATTTGGTATCAGCAACAGCTTGATCCAGTAACAGGGGAAAATTTGGGAAAGCCTCTTAAAATTCCACCGGA
TGATCTGATCAACATCGCAGGAATCTCACAAGTGCCTGATGGTGAAGCTTCTTGGCATGTGACAGTGAGCAAATACATGG
ACTCTCCGCTTCTCTCAGCGGCTTTGCCTGTCTTTGATGCATCAAACAAGAGTATTGTGGCTGTTGTGGGGGTGACAACT
GCACTTTACAGCGTAGGACAGTTGATGAGAGATCTTGTAGAAGTCCACGGTGGACATATTTATTTGACATCTCAAGAAGG
ATACTTGCTTGCTACCTCCACAGATGGTCCTCTTTTGAAAAATACATCAAACGGGCCTCAGCTAATGAAAGCCACTGATT
CAGAAGAGTGGGTTATAAAGTCAGGAGCTCAGTGGTTAGAGAAAACTTATGGAAGTAAGCGCCCTCACGTTGTTCATGCT
GAGAATGTAAAGCTTGGTGACCAACGATATTACATTGATTCATTCTATCTTAATCTCAAGAGACTTCCAATTGTAGGTGT
TGTCATTATTCCCAGGAAGTTCATTATGGGAAAAGTGGATGAAAGGGCCTTCAAGACTTTGATTATTCTGATTTCTGCTT
CTGTCTGCATCTTCTTTATTGGATGTGTCTGCATTTTAATACTCACAAATGGAGTTTCAAAGGAGATGAAGCTAAGAGCA
GAACTGATAAGGCAACTGGATGCAAGAAGAAGAGCTGAAGCTTCAAGCAACTACAAAAGCCAGTTTTTGGCAAATATGAG
TCATGAGTTGAGGACACCAATGGCTGCTGTAATTGGATTACTAGATATTCTTATATCGGATGATTGTCTTTCAAATGAGC
AATACGCAACAGTCACTCAGATCAGAAAGTGCTCTACAGCTCTCCTTCGGCTTCTCAATAATATACTGGACTTGAGCAAG
GTTGAGTCAGGAAAGCTTGTTCTGGAAGAAGCTGAGTTTGATTTGGGGCGAGAACTTGAAGGACTTGTTGACATGTTCTC
GGTGCAGTGTATTAATCACAATGTAGAGACAGTTCTAGACCTCTCTGATGATATGCCAGCATTAGTCAGAGGAGACTCAG
CAAGACTTGTTCAAATATTTGCAAATCTTATAAGCAATTCTATAAAGTTTACAACAACGGGTCACATTATTCTTCGTGGA
TGGTGCGAGAACATAAATTCTCTACATGATGAGATGAGCGTATCTGTTGACAGAAGGAAACCATGGGCTCCAATGAAGAC
AAAACAGGTGCAACACAGAAATCACTTGCAGAAGTCTTGTAAGAACGCGAACAAAATGGTTCTTTGGTTTGAGGTTGATG
ATACTGGATGTGGAATAGATCCAAGCAAATGGGACTCTGTTTTTGAGAGCTTTGAGCAAGCTGATCCTTCTACCACTCGG
ACGCACGGAGGAACTGGACTTGGACTATGTATTGTGCGAAACTTGGTTAACAAAATGGGTGGAGAAATCAAAGTAGTGCA
GAAGAATGGCTTAGGGACTCTTATGAGACTGTACTTGATTTTGAGTACTCCTGACACTGTAGATCAAAACATCCAGCCAG
ATTTCTCCAAATACGGTCTCGTGGTTATGCTTTCCATGTATGGAAGTACAGCAAGAATGATCACATCAAAGTGGTTGCGA
AAACACGGCATTGCAACTGTTGAAGCATCAGACTGGAACGAGCTGACTCAGATCATTAGAGACCTCTTGGAGACGGGAAG
CCGTGACAACAGCTTTGATTCACAGCACAATATATCTGATCCACTGAGAGCAGAGCTTTCAAATATAGTAGAAATCAAGA
ACCCTGTGTTTGTCATAGTGGTGGATATCGGAGTACTTGATCTCACCACAAATATATGGAAGGAACAGCTTAACTACCTC
GACAGATTCTCCAACAAAGCAAAGTTTGCTTGGCTACTGAAGCATGACACCTCCAATACAGTTAAAACAGAACTTAGACG
AAAAGGGCATGTCATGATGGTTAACAAACCGTTGTACAAGGCCAAAATGATCCAGATTCTGGAGGCTGTAATAAAAAACC
GGAAGAGAGGCTTGTGTAATGACTTAAGAAACAGAGGAAACGGAAGTGATGAATCCCACGATTGCTTAGAAATTGATCCA
ACACAATTCGACACTTGCAGTTCCGATGATTCCTCGGAGACATCTGGCGAGAAACAAGTAGATAAATCTGTTAAACCAAG
CACCTTGCACTCTCCAGTGCTTAAGAACTATCTCATCGATGCCACTACCAGCAATGATGACTCAACATCTGCAAGTATGA
CTCAAAAGAACCCAGAAGAAGAAGATTGGAAGGATCGGCTGTATTCAGGAATTGCGTTGGATGGAAAGAATCAGAAATCT
CTTGAAGGTATAAGGATCTTGCTGGCAGAGGATACACCCGTTCTTCAACGAGTAGCCACCATAATGCTTGAGAAAATGGG
AGCAACTGTAACTGCAGTCTGGGATGGACAACAAGCAGTTGATTCCCTCAACTACAAGTCTATCAATGCTCAAGCTCCAA
CTGAAGAACACAAATCGTTCGAAGAAGAAACCGCTAACAAAGTTACAACTCGGGAGACTAGTTTACGGAATTCCTCGCCT
TATGACTTGATCCTCATGGACTGCCAGATGCCAAAAATGGATGGATATGAGGCAACAAAGGCGATAAGGAGAGCAGAGAT
TGGCACAGAGCTGCACATTCCAATCGTGGCGTTGACAGCGCATGCAATGTCTTCTGATGAAGCGAAATGCTTGGAGGTTG
GAATGGATGCTTATCTCACAAAGCCTATTGATCGAAAGCTTATGGTCTCTACCATTTTGTCACTCACTAAACCATCAGCA
TTCCAAACTTCATTGTCCGCTTGA