Details for Arabidopsis Locus AT2G17787

Position : Chr2 ( 5`- 7731075 .. 7733019 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT2G17787

Protein [Map View]
MSRCYPFPPPGYVWKESLIESIKGAKEEVKKDRKHKRNEKDRKDRDNEAGRSRKHRHKRRRKDEGAIASGKLVSSEVELL
EKSCQTVELELQTSSQNSCDSTLHSNERPKQIQSQPLDETSIRTRLPDKGQEDPEDGVMMTSKDQKQRFSREMLDASQAA
TAPNESVGHSRVCQEKRIDPTFGSSREITTKLNKEKKSVPSKDNRKVSKEKKMPSLSSCNPLEQEKPTSSHQETPGPSKL
LCRKCPPSMAGQLLNLIENWAPDRVESKLTDSEDQEWWLFIKFGAKSPQVSNQKTNQGSSSMVWPTARFLPEAEVHALPF
TVPF*

DNA
ATGTCTCGGTGTTATCCGTTTCCACCACCTGGTTATGTTTGGAAAGAAAGTCTGATCGAATCGATCAAGGGGGCAAAGGA
GGAAGTGAAGAAAGATAGAAAACACAAGAGGAATGAAAAAGATAGAAAGGATAGGGATAATGAGGCGGGGAGGAGCAGGA
AGCATCGGCATAAGAGACGGCGGAAAGATGAAGGCGCCATTGCTAGTGGCAAATTAGTAAGCAGTGAGGTCGAGTTGTTA
GAGAAGAGCTGCCAGACTGTGGAACTTGAGCTTCAAACATCGTCTCAGAATTCTTGTGATAGCACTCTTCATAGCAATGA
GAGACCAAAGCAAATTCAGAGTCAGCCCCTTGATGAAACCAGCATACGGACTCGGTTACCTGACAAAGGGCAGGAAGATC
CTGAGGATGGGGTGATGATGACCAGCAAGGATCAAAAACAGCGCTTTTCCCGGGAAATGTTAGATGCTTCTCAAGCTGCT
ACTGCTCCTAATGAGTCTGTTGGTCATTCAAGGGTCTGTCAAGAGAAAAGAATAGATCCAACTTTTGGTTCGTCGAGAGA
GATCACAACAAAACTCAACAAAGAGAAGAAGTCAGTTCCTTCGAAAGATAACAGAAAAGTTAGTAAAGAGAAGAAGATGC
CATCATTATCTTCATGTAACCCTCTGGAACAAGAGAAACCGACCTCTAGTCATCAAGAAACCCCTGGACCTTCCAAGCTA
TTATGCAGGAAATGCCCTCCTTCCATGGCTGGGCAACTCTTGAATCTTATCGAGAACTGGGCTCCTGATCGGGTTGAGAG
CAAGCTCACTGACTCTGAAGATCAAGAATGGTGGTTGTTCATCAAGTTTGGAGCCAAAAGTCCACAAGTTAGCAATCAGA
AAACCAACCAGGGAAGTAGTTCCATGGTGTGGCCGACTGCTAGATTTCTTCCTGAAGCCGAAGTACACGCATTGCCATTC
ACTGTCCCGTTCTGA