Details for Arabidopsis Locus AT2G17780

Position : Chr2 ( 5`- 7724885 .. 7727404 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT2G17780

Protein [Map View]
MANSWDQLGEIASVAQLTGIDALKLIGMIVNAANTARMHKKNCRQFAHHLKLIRNLLEQIKNSEMNQRSEILEPLQGLDD
ALRRSYILVKSCQEKSYLYLLAMGWNIVNQFEKAQNEIDLFLKIVPLINMADNARIRERLEAIERDQREYTLDEEDRKVQ
DVILKQESTREAATSVLKKTLSRSYPNMGFCEALKTEEEKLQLELQRSRARYDADQCEVIQRLIDVTQTAATVEPNLEKV
LTKKEELTSSKKRDDLYDTDSSSIRADSRSTSYVSSGHELLSGRSLQHRGNWHADLLDCCSEPCLCLKTLFFPCGTLAKI
STVATSRQISSTEVCKNLIVYSLILSCCCYTCCIRKKLRKTLNITGGCIDDFLSHLMCCCCALVQELREVEIHRASYGTE
KSNKEMSPPTPQFMEE*

DNA
ATGGCTAATTCATGGGATCAGTTAGGAGAAATTGCGTCAGTGGCTCAGCTTACAGGCATAGACGCTCTGAAACTGATTGG
AATGATAGTAAACGCTGCGAATACAGCTCGAATGCACAAGAAGAATTGTCGTCAATTCGCTCACCATCTTAAGCTCATCC
GTAATTTGCTAGAGCAGATTAAAAACTCTGAGATGAATCAACGTTCAGAGATTCTTGAGCCGCTTCAAGGACTTGATGAT
GCTCTTAGAAGATCTTACATTTTAGTCAAAAGTTGTCAAGAAAAAAGTTATCTTTACTTGTTGGCTATGGGCTGGAACAT
TGTTAACCAGTTTGAAAAAGCTCAGAATGAGATTGATCTGTTTCTCAAGATCGTTCCACTAATAAATATGGCGGATAATG
CTCGGATTCGGGAGAGGCTAGAAGCTATTGAACGTGATCAGCGTGAGTATACTCTTGATGAAGAGGATAGAAAGGTGCAA
GATGTTATTTTGAAACAAGAATCTACTAGAGAAGCTGCTACATCGGTTTTAAAGAAGACGCTCTCTCGTTCATACCCGAA
CATGGGGTTCTGCGAAGCGCTTAAAACCGAGGAGGAGAAACTGCAACTTGAGTTGCAACGTTCGCGGGCGCGGTATGATG
CTGATCAATGTGAAGTTATACAACGTTTGATTGATGTTACACAAACTGCTGCTACTGTTGAACCTAATCTTGAAAAGGTG
TTGACTAAGAAAGAAGAGCTTACCTCTAGCAAGAAGAGAGATGATTTGTATGACACGGATAGTAGTAGTATTCGAGCAGA
TTCAAGATCAACGTCTTATGTTTCATCCGGACATGAACTACTTTCGGGAAGATCATTGCAACACCGTGGAAATTGGCACG
CCGACTTGCTGGATTGTTGTTCAGAACCTTGTCTTTGCTTGAAGACACTCTTTTTCCCCTGTGGTACATTGGCAAAGATT
TCCACTGTGGCAACTAGTAGGCAAATCTCTTCAACTGAAGTGTGTAAGAACCTAATCGTGTATTCTTTGATACTCTCATG
CTGTTGCTATACTTGCTGCATAAGGAAGAAGCTTCGAAAGACACTGAACATAACGGGAGGGTGCATTGACGACTTTTTGT
CACATCTAATGTGTTGTTGTTGTGCCCTTGTCCAAGAACTGAGAGAAGTCGAGATTCATCGAGCTTCTTACGGTACAGAG
AAGAGTAATAAGGAAATGAGTCCACCAACACCTCAGTTTATGGAAGAATGA