Details for Arabidopsis Locus AT2G17760

Position : Chr2 ( 5`- 7713314 .. 7716464 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT2G17760

Protein [Map View]
MVWYSSCRILFLGLLILLASSWVLDRCEGFGEFGFEFHHRFSDQVVGVLPGDGLPNRDSSKYYRVMAHRDRLIRGRRLAN
EDQSLVTFSDGNETVRVDALGFLHYANVTVGTPSDWFMVALDTGSDLFWLPCDCTNCVRELKAPGGSSLDLNIYSPNASS
TSTKVPCNSTLCTRGDRCASPESDCPYQIRYLSNGTSSTGVLVEDVLHLVSNDKSSKAIPARVTFGCGQVQTGVFHDGAA
PNGLFGLGLEDISVPSVLAKEGIAANSFSMCFGNDGAGRISFGDKGSVDQRETPLNIRQPHPTYNITVTKISVGGNTGDL
EFDAVFDSGTSFTYLTDAAYTLISESFNSLALDKRYQTTDSELPFEYCYALSPNKDSFQYPAVNLTMKGGSSYPVYHPLV
VIPMKDTDVYCLAIMKIEDISIIGQNFMTGYRVVFDREKLILGWKESDCYTGETSARTLPSNRSSSSARPPASSFDPEAT
NIPSQRPNTSTTSAAYSLSISLSLFFFSILAIL*

DNA
ATGGTTTGGTACTCAAGCTGTAGAATTTTGTTTCTGGGTCTGCTTATTTTGTTGGCTTCGAGCTGGGTTTTGGATAGATG
CGAGGGATTTGGTGAATTTGGGTTTGAATTTCATCATCGTTTCTCCGATCAGGTTGTTGGGGTTTTGCCTGGAGATGGTT
TACCTAATCGAGATTCTTCTAAGTATTATAGAGTGATGGCTCATCGTGATCGGTTAATTAGAGGTCGTCGACTTGCAAAT
GAAGATCAATCACTCGTTACTTTCTCTGACGGCAACGAAACTGTTCGTGTTGATGCCCTAGGATTTTTGCATTACGCTAA
TGTGACTGTTGGGACGCCGTCTGATTGGTTTATGGTTGCTTTAGATACTGGAAGTGACTTGTTTTGGTTGCCCTGTGACT
GCACCAATTGTGTTCGTGAATTGAAAGCACCTGGTGGCTCGAGTTTGGACCTTAATATTTATAGCCCTAATGCTTCATCG
ACAAGTACTAAAGTTCCTTGTAATAGCACATTATGTACAAGAGGTGATCGATGCGCTTCCCCTGAAAGTGATTGCCCATA
CCAGATCCGGTATCTTTCTAATGGTACCTCTTCTACTGGAGTCTTGGTGGAGGATGTACTTCACTTAGTTTCAAATGACA
AAAGTTCCAAAGCTATTCCCGCTCGTGTTACTTTTGGATGTGGTCAAGTTCAGACCGGTGTATTCCATGATGGTGCAGCT
CCAAATGGTCTTTTCGGGCTTGGCTTAGAAGACATATCGGTGCCTAGTGTACTAGCAAAAGAAGGAATTGCAGCAAACTC
ATTCTCAATGTGTTTTGGGAACGATGGAGCTGGTAGGATCAGTTTTGGAGATAAAGGTAGCGTAGACCAACGGGAAACAC
CATTGAACATAAGACAACCACATCCTACTTACAATATCACCGTCACTAAAATAAGCGTTGGAGGAAATACCGGCGATCTT
GAATTTGATGCTGTTTTTGACTCTGGAACCTCGTTCACTTATCTGACTGATGCAGCTTACACCCTTATTTCAGAAAGCTT
TAATTCTCTAGCTCTGGACAAACGTTATCAAACAACTGATTCTGAGTTGCCTTTTGAGTACTGTTATGCATTAAGCCCAA
ACAAAGACAGCTTCCAGTATCCAGCTGTGAATCTGACAATGAAAGGCGGGAGCTCGTATCCCGTTTATCACCCGTTAGTA
GTAATCCCCATGAAGGACACAGATGTCTACTGTTTAGCCATTATGAAGATAGAAGACATTAGCATCATTGGACAGAACTT
CATGACTGGCTATCGCGTTGTCTTTGATCGTGAGAAACTGATTCTGGGGTGGAAAGAATCTGATTGTTACACCGGTGAGA
CATCGGCTCGGACGCTTCCATCGAACCGTTCCTCCTCCTCGGCTAGACCGCCAGCTTCTTCGTTTGACCCAGAGGCGACA
AACATACCATCTCAAAGACCAAACACGTCGACGACTTCTGCTGCTTATTCTCTCTCTATCTCACTTTCATTGTTCTTCTT
CTCAATTTTGGCCATCCTTTAA