Details for Arabidopsis Locus AT2G17730

Position : Chr2 ( 5`- 7703856 .. 7705750 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT2G17730

Protein [Map View]
MASSSSSSYRFQSGSYPLSSSPSLGNFVERIKDACHFLVSAVLGTIISAILTFFFALVGTLLGALTGALIGQETESGFIR
GAAIGAISGAVFSIEVFESSLDLWKSDESGFGCFLYLIDVIVSLLSGRLVRERIGPAMLSAVQSQMGAVDTAFDDHTSLF
DTGGSKGLTGDLVEKIPKMTITGNNNTDASENTDSCSVCLQDFQLGETVRSLPHCHHMFHLPCIDNWLLRHDISTARTSR
VCSALLPSSLSFM*

DNA
ATGGCCTCGTCATCATCATCATCTTATAGATTCCAATCTGGGTCTTACCCTCTTTCGTCAAGTCCTTCTCTTGGGAATTT
CGTCGAACGCATTAAAGACGCTTGTCATTTCCTTGTCTCTGCTGTTTTGGGTACCATTATCTCCGCGATCTTGACCTTCT
TCTTCGCACTAGTGGGCACATTGCTAGGGGCACTTACAGGAGCTTTGATAGGTCAAGAAACTGAGAGTGGTTTCATTAGA
GGAGCAGCAATTGGAGCCATTTCGGGAGCTGTTTTCTCTATCGAGGTCTTTGAATCATCTCTGGATCTCTGGAAATCCGA
TGAGTCGGGTTTCGGATGTTTTCTCTACTTGATTGATGTCATTGTTAGTCTTCTAAGCGGGAGACTTGTACGAGAGCGCA
TTGGTCCTGCAATGCTAAGTGCAGTGCAAAGTCAAATGGGAGCTGTGGATACAGCTTTTGATGATCACACAAGCCTTTTT
GATACAGGAGGCTCAAAAGGATTGACAGGAGACCTTGTTGAGAAAATCCCAAAGATGACAATCACTGGCAACAATAACAC
TGATGCTTCTGAGAACACAGACTCATGTTCTGTTTGTCTTCAGGATTTCCAGCTCGGTGAAACAGTTAGAAGCTTGCCTC
ATTGTCATCACATGTTTCACTTACCTTGCATAGACAATTGGCTCCTTAGACACGATATTTCTACAGCTCGTACATCAAGA
GTCTGCTCTGCTCTTCTTCCCTCCTCCTTGAGTTTCATGTAA