Details for Arabidopsis Locus AT2G17723

Position : Chr2 ( 5`- 7700134 .. 7700675 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT2G17723

Protein [Map View]
MKSSIFFKLLLLVSLLVVIFRQSYAVADYCNRDADCKRVCLRPYACNLTRHLCMCHPNDVSSSKQHCIPEHKGFGEGGPP
PQRLKLYR*

DNA
ATGAAGAGCAGCATATTCTTTAAGCTTCTGTTATTGGTTTCTCTTTTAGTCGTTATCTTCAGACAAAGCTATGCAGTCGC
CGATTATTGTAATAGAGATGCTGACTGTAAGCGGGTATGCTTAAGACCGTACGCATGCAACTTAACCCGTCACCTTTGTA
TGTGTCATCCAAATGATGTCAGTTCTTCTAAACAACATTGTATTCCAGAACATAAAGGTTTTGGAGAAGGAGGACCTCCA
CCACAACGATTGAAATTATATCGATAA