Details for Arabidopsis Locus AT2G17710

Position : Chr2 ( 5`- 7693596 .. 7694746 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT2G17710

Protein [Map View]
MNMKKQIMDESVKSLMLPPPPPLLPPSQGYGSRKIDGDSITNKQIKKFWRQKQIIEEDHLYSAIKAAARVRARNLSDEDY
KRFEESLDMEDLETEDHQGLKDWWTKSKYAYLNQPALGSADSLKRKRFSTYTPNCFSFKPCNPLYATSLNVF*

DNA
ATGAATATGAAGAAACAGATTATGGATGAGTCTGTAAAGTCATTGATGCTGCCTCCTCCTCCACCGCTTCTTCCTCCATC
TCAGGGATATGGATCAAGAAAGATCGATGGAGACAGCATAACCAATAAACAGATCAAGAAGTTCTGGAGACAGAAGCAGA
TCATTGAAGAGGATCATCTCTATTCTGCTATTAAGGCTGCAGCTCGTGTCAGAGCTCGTAATCTCTCTGATGAGGACTAC
AAACGCTTTGAAGAAAGCTTGGACATGGAGGACCTGGAAACCGAAGATCATCAGGGATTGAAAGACTGGTGGACAAAGAG
CAAATACGCGTACTTGAACCAGCCGGCTCTTGGATCTGCAGATTCACTGAAGAGAAAGAGGTTTTCGACTTATACACCAA
ACTGTTTCTCGTTCAAGCCTTGCAATCCTCTCTACGCAACTTCGCTCAATGTCTTTTGA