Details for Arabidopsis Locus AT2G17695

Position : Chr2 ( 5`- 7684112 .. 7685187 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT2G17695

Protein [Map View]
MVFLSWGRPSSEQQQQVINKTGTFNYDNKYRGVSSRSIAKLKEDSEIDKDGFLINHARVLVGSGRESYEKGKKALQNWKH
FGMDWAFVDPATPVETGKKFCICVKEVLPWVMLPLQVVYVDESRKSRKGPAHFGYGSGTLQGHLLAGEEKFSIELDGNGE
VWYEITSFSKPAHFLSFLGYPYVKLRQKHFARHSSEAVLKHVNAS*

DNA
ATGGTGTTCTTGAGTTGGGGCCGTCCATCTTCCGAGCAACAGCAACAAGTCATCAACAAAACAGGAACCTTCAATTATGA
CAACAAGTACAGAGGAGTTTCGTCTAGGTCTATTGCTAAACTTAAGGAAGATTCAGAGATTGATAAAGATGGATTCTTGA
TCAATCATGCTCGTGTTTTAGTCGGTTCTGGTAGAGAGAGTTATGAGAAGGGCAAAAAAGCTCTCCAGAATTGGAAGCAT
TTTGGTATGGATTGGGCATTTGTTGATCCTGCAACACCTGTTGAAACCGGTAAGAAGTTTTGCATTTGCGTGAAAGAAGT
TCTTCCATGGGTGATGCTTCCTCTACAAGTGGTTTATGTTGACGAAAGCCGGAAATCAAGAAAAGGCCCTGCGCATTTCG
GTTACGGAAGCGGTACTCTTCAGGGACATTTACTCGCTGGAGAAGAAAAGTTTTCGATAGAGCTTGATGGAAATGGTGAG
GTATGGTATGAGATAACGTCTTTCTCAAAGCCTGCTCATTTCTTGTCGTTCCTCGGGTATCCTTATGTGAAGCTAAGGCA
GAAGCACTTTGCTCGTCATTCTTCTGAAGCTGTGCTGAAACATGTCAATGCTTCGTGA