Details for Arabidopsis Locus AT2G17670

Position : Chr2 ( 5`- 7674351 .. 7676157 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT2G17670

Protein [Map View]
MGKVPSSFRSMPANLLVRKTTPSPPAPPRDFRNRTAVGGDSAKLPQNTQAPREPSLRNPFKSPNLSDAKSLFNSIAATSR
IPLDLKFHNSVLQSYGSIAVVNDTVKLFQHILKSQPNFRPGRSTFLILLSHACRAPDSSISNVHRVLNLMVNNGLEPDQV
TTDIAVRSLCETGRVDEAKDLMKELTEKHSPPDTYTYNFLLKHLCKCKDLHVVYEFVDEMRDDFDVKPDLVSFTILIDNV
CNSKNLREAMYLVSKLGNAGFKPDCFLYNTIMKGFCTLSKGSEAVGVYKKMKEEGVEPDQITYNTLIFGLSKAGRVEEAR
MYLKTMVDAGYEPDTATYTSLMNGMCRKGESLGALSLLEEMEARGCAPNDCTYNTLLHGLCKARLMDKGMELYEMMKSSG
VKLESNGYATLVRSLVKSGKVAEAYEVFDYAVDSKSLSDASAYSTLETTLKWLKKAKEQGLVP*

DNA
ATGGGGAAAGTTCCGTCGTCGTTTCGTAGTATGCCGGCGAACTTATTGGTCAGAAAAACAACACCATCTCCTCCAGCGCC
GCCGCGAGATTTTCGCAACAGAACCGCCGTGGGAGGAGATTCAGCCAAACTTCCCCAGAATACTCAAGCCCCTCGCGAGC
CCTCCTTGAGGAATCCATTCAAGTCACCAAATCTCTCAGACGCTAAAAGCCTCTTCAATTCAATCGCCGCCACTTCACGA
ATCCCACTCGATCTCAAGTTCCACAACTCTGTTCTTCAATCATACGGTTCAATCGCCGTCGTCAACGATACGGTGAAACT
CTTTCAGCATATTTTGAAATCGCAGCCTAATTTCAGGCCGGGACGTTCAACGTTCCTTATCTTGCTTTCACATGCTTGTA
GAGCTCCTGATTCGTCGATTTCGAATGTTCATAGAGTTCTTAATCTCATGGTTAATAATGGTTTAGAGCCTGATCAAGTA
ACTACCGATATCGCGGTGAGGTCTCTTTGCGAAACGGGTCGGGTTGATGAAGCTAAGGATTTGATGAAGGAGCTCACTGA
GAAACACTCTCCTCCGGATACATATACTTATAACTTTCTACTGAAGCATTTGTGCAAATGCAAAGATCTTCATGTTGTTT
ATGAGTTTGTTGATGAGATGAGAGATGATTTCGATGTTAAGCCGGATCTTGTTAGCTTCACTATCTTGATTGATAATGTT
TGTAACTCTAAGAACTTGAGGGAGGCAATGTATCTAGTTAGTAAGTTAGGTAATGCTGGGTTTAAGCCGGATTGTTTCCT
CTATAACACGATTATGAAAGGTTTTTGCACACTGAGTAAAGGGAGTGAGGCGGTTGGTGTGTATAAGAAAATGAAGGAAG
AAGGTGTTGAGCCAGATCAGATTACCTACAATACTTTGATATTTGGACTGTCGAAAGCTGGTAGAGTTGAGGAAGCTAGG
ATGTATTTGAAAACTATGGTTGATGCGGGGTATGAGCCGGATACTGCTACTTACACATCACTGATGAATGGAATGTGTAG
AAAAGGTGAGTCTTTAGGTGCGTTGAGTTTGTTAGAAGAAATGGAAGCAAGAGGGTGTGCTCCAAATGATTGTACTTATA
ATACTTTGCTTCATGGATTGTGTAAAGCAAGGTTGATGGATAAAGGGATGGAGTTATATGAAATGATGAAATCAAGTGGT
GTAAAGCTTGAGAGTAATGGTTATGCTACACTTGTGAGGTCTCTGGTTAAAAGTGGCAAGGTCGCAGAGGCTTATGAAGT
GTTTGATTATGCAGTTGATAGCAAGAGTTTGTCAGATGCTTCTGCGTACTCTACACTTGAAACTACCTTGAAATGGTTGA
AAAAAGCTAAAGAACAAGGCTTGGTTCCATAA