Details for Arabidopsis Locus AT2G17660

Position : Chr2 ( 5`- 7673282 .. 7673712 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT2G17660

Protein [Map View]
MASNEAGRALPKFGEWDVNDPATADGFTVIFSKAGEDKKTGRSSTKTNSQRKQDGDKPAVKKWLCFTFA*

DNA
ATGGCGTCGAATGAAGCTGGAAGGGCATTGCCGAAATTCGGGGAATGGGATGTGAATGATCCAGCGACGGCGGATGGATT
CACGGTGATATTCAGCAAAGCCGGTGAAGATAAAAAGACGGGACGGAGTTCGACGAAGACGAATTCACAGAGGAAACAAG
ATGGTGATAAACCAGCGGTCAAGAAATGGCTCTGTTTCACTTTTGCTTAA