Details for Arabidopsis Locus AT2G17640

Position : Chr2 ( 5`- 7668078 .. 7670495 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT2G17640

Protein [Map View]
MNGDELPFESGFEVYAKGTHKSEFDSNLLDPRSDPIWDAIREEAKLEAEKEPILSSFLYAGILAHDCLEQALGFVLANRL
QNPTLLATQLLDIFYGVMMHDKGIQSSIRHDLQAFKDRDPACLSYSSAILHLKGYHALQAYRVAHKLWNEGRKLLALALQ
SRISEVFGIDIHPAARIGEGILLDHGTGVVIGETAVIGNGVSILHGVTLGGTGKETGDRHPKIGEGALLGACVTILGNIS
IGAGAMVAAGSLVLKDVPSHSVVAGNPAKLIRVMEEQDPSLAMKHDATKEFFRHVADGYKGAQSNGPSLSAGDTEKGHTN
STS*

DNA
ATGAATGGCGATGAGCTTCCTTTCGAGAGTGGTTTCGAGGTTTACGCTAAGGGAACTCATAAGTCAGAGTTTGACTCGAA
TTTGCTTGATCCTCGTTCTGATCCTATTTGGGATGCTATAAGAGAAGAAGCTAAACTTGAGGCAGAGAAAGAGCCTATTT
TGAGTAGCTTCTTGTATGCTGGTATCTTAGCACATGATTGTTTAGAGCAAGCTTTAGGGTTTGTTCTAGCCAACCGTCTC
CAAAACCCAACCTTGTTGGCAACACAACTCTTGGATATATTTTATGGTGTTATGATGCATGACAAAGGTATTCAGAGTTC
GATTCGCCATGATCTCCAGGCATTTAAAGATCGTGATCCTGCTTGTCTGTCGTATAGTTCTGCTATTTTACATCTGAAGG
GTTATCATGCGTTACAAGCATATAGGGTTGCGCATAAACTGTGGAATGAAGGGAGGAAACTATTAGCTCTTGCATTGCAA
AGCCGAATAAGCGAGGTTTTTGGCATTGACATACATCCAGCGGCAAGAATTGGGGAGGGAATATTGTTGGATCATGGAAC
TGGAGTGGTCATTGGTGAGACCGCTGTGATAGGCAACGGTGTCTCGATCTTACATGGTGTGACTTTAGGAGGAACCGGAA
AGGAAACTGGCGATCGCCACCCAAAGATAGGTGAAGGTGCATTGCTTGGAGCTTGTGTGACTATACTTGGTAACATAAGC
ATAGGTGCTGGAGCAATGGTAGCTGCAGGTTCACTTGTGTTAAAAGACGTTCCTTCGCATAGTGTGGTGGCTGGAAATCC
TGCAAAACTGATCAGGGTCATGGAAGAGCAAGACCCGTCTCTAGCAATGAAACACGATGCTACTAAAGAGTTCTTTCGAC
ATGTAGCTGATGGTTACAAAGGGGCACAATCTAACGGACCATCACTTTCAGCAGGAGATACAGAGAAAGGACACACTAAC
AGCACATCATGA