Details for Arabidopsis Locus AT2G17630

Position : Chr2 ( 5`- 7666585 .. 7668065 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT2G17630

Protein [Map View]
MAASTNSFLIGNQTQIPSLKPKSISQSFIHFTKPNTINLTTRTKSVSIRCASASTTVGSEQRVINFAAGPAALPENVLLK
AQSDLYNWRGSGMSVMEMSHRGKEFLSIIQKAESDLRQLLEIPSEYSVLFLQGGATTQFAALPLNLCKSDDSVDYIVTGS
WGDKAFKEAKKYCNPKVIWSGKSEKYTKVPTFDGLEQSSDAKYLHICANETIHGVEFKDYPLVENPDGVLIADMSSNFCS
KPVDVSKFGVIYAGAQKNVGPSGVTIVIIRKDLIGNARDITPVMLDYKIHDENSSLYNTPPCFGIYMCGLVFDDLLEQGG
LKEVEKKNQRKAELLYNAIDESRGFFRCPVEKSVRSLMNVPFTLEKSELEAEFIKEAAKEKMVQLKGHRSVGGMRASIYN
AMPLAGVEKLVAFMKDFQARHA*

DNA
ATGGCGGCGTCAACGAACTCATTCCTCATCGGAAACCAAACCCAAATCCCTTCTTTGAAACCCAAATCAATATCCCAATC
CTTTATCCACTTCACTAAACCCAACACCATCAACCTCACCACCCGAACCAAATCCGTTTCAATCCGATGCGCTTCCGCTT
CAACCACCGTCGGATCCGAGCAGCGAGTCATCAATTTCGCCGCAGGTCCAGCCGCATTACCGGAAAACGTCCTCCTCAAA
GCTCAATCAGATCTCTATAACTGGCGTGGATCTGGTATGAGTGTTATGGAGATGAGTCATCGCGGTAAAGAGTTTCTCTC
AATCATTCAAAAAGCTGAATCTGATCTCCGTCAGCTTCTCGAGATTCCATCGGAATATTCCGTTTTGTTCTTACAAGGTG
GTGCCACTACTCAATTCGCTGCTTTACCTCTCAATCTCTGTAAATCTGATGATTCCGTTGATTACATTGTTACTGGATCT
TGGGGAGATAAAGCTTTTAAGGAAGCTAAGAAATATTGTAACCCTAAAGTGATTTGGTCTGGTAAATCTGAGAAATATAC
TAAAGTTCCAACCTTTGATGGATTGGAGCAGAGTTCGGACGCCAAGTATTTGCATATATGCGCCAATGAGACTATTCATG
GTGTTGAATTTAAAGATTATCCTCTTGTTGAAAACCCTGATGGTGTTCTTATTGCTGATATGTCTTCGAATTTCTGTTCT
AAGCCGGTGGATGTATCGAAGTTCGGTGTGATTTACGCTGGTGCTCAGAAGAATGTTGGTCCTTCTGGTGTCACCATTGT
GATCATTCGAAAGGATTTGATTGGGAATGCTAGAGATATAACTCCGGTGATGCTTGATTACAAGATTCATGATGAGAACA
GCTCGTTGTATAACACGCCACCGTGTTTCGGGATTTATATGTGTGGTCTTGTGTTTGATGATTTGTTGGAGCAAGGTGGT
TTGAAGGAAGTGGAGAAGAAGAACCAGAGGAAAGCTGAGTTGTTGTACAATGCGATTGATGAGAGTAGAGGGTTTTTCAG
GTGTCCTGTTGAGAAGTCTGTGAGGTCTTTGATGAATGTTCCTTTTACGTTGGAGAAATCGGAGTTGGAAGCTGAGTTTA
TTAAAGAAGCTGCTAAGGAGAAGATGGTGCAGCTTAAGGGACATAGATCAGTGGGAGGTATGAGAGCTTCTATTTACAAT
GCGATGCCATTGGCTGGTGTCGAAAAGCTTGTTGCTTTCATGAAAGATTTTCAGGCAAGGCATGCTTGA