Details for Arabidopsis Locus AT2G17580

Position : Chr2 ( 5`- 7646463 .. 7650320 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT2G17580

Protein [Map View]
MAGFIKRKGNVFFHSQALAAVYSKLQRSNCTLAEGFMEKCSSIRQVIDEDINSVDTSKWKKVRASDAGIKNSMIPESSMN
VLRLLRRQGFDAYLVGGCVRDLILNRVPKDYDVITTADLKQIRRLFHRAQVIGKRFPICHVWMGGSIIEVSSFDTVAHSD
SDLEKSKEKSGVSLDTKANKNNSLFKMYSGWDIKDCKRWRNSLQRDFTINSLFYNPFDFTIYDYANGMEDLTDLKLRTLV
PAHLSFKEDCARILRGLRIAARLGLSLSKDVKTAIPEFVSSVANLDQFRLIMEMNYMLAYGAAAPSILLLMKFKLLHVLL
PFQAAYLDQASKTSLSSSLMLVRLFSNMDKLVSCDQPADPKLWIAVLAFHIALVRNPQEAIVVRAFAALLYHGNWSKAVE
FAREHETSVIGYAPEVSKSSRKRSDEDLAEAVSEFTCLLKDTQYVLTDKEALREALYLYPDFKFSGLVFIPKKKGRDVAE
GFMRLSDVESYESQKEGFSIDYVLLGKGNPCEVRFVLGKIILDTITEGTVIEPLNSVKKKQSTRNHIVPAACLEKKDELF
VSKSSKEDNNNQTPVHDSNASSVLKILKRTREDSEQNNDQETEVCPRTPSGPAKNQDQSVVQMLKRRRSKEAPVSEPPKQ
KTSKRSRSDDQEAVGSLSVPAKIQHQSNKHDTNAPICELPKQKTSKNHSKESRKVKHNDLPVKEIKEAKQGFVSDKSMSD
LLQVLEKSSQQVSSKEENNSLSSEKTNRPRKLSSLFR*

DNA
ATGGCGGGTTTCATTAAACGCAAAGGCAACGTATTTTTTCATTCTCAAGCCTTAGCTGCTGTCTACTCCAAGTTGCAGAG
AAGTAATTGCACGCTTGCTGAGGGATTCATGGAGAAGTGTTCTAGCATTCGTCAAGTTATTGATGAAGATATAAATTCAG
TTGATACATCTAAGTGGAAGAAGGTACGAGCAAGTGATGCTGGAATTAAAAATTCAATGATCCCTGAATCCTCTATGAAT
GTCTTGAGACTCCTTAGACGTCAAGGTTTCGATGCATACCTTGTTGGTGGATGTGTAAGGGATTTAATACTGAATAGAGT
GCCAAAAGACTATGATGTGATCACTACAGCTGATCTTAAGCAGATCCGGCGGCTGTTTCATCGTGCTCAGGTTATTGGGA
AACGGTTTCCTATTTGTCATGTTTGGATGGGAGGTTCGATAATTGAGGTGTCCAGTTTTGATACCGTGGCACACAGTGAC
AGTGATTTGGAGAAGTCTAAAGAGAAATCTGGTGTCTCACTGGATACCAAGGCAAACAAGAATAACAGCCTCTTCAAAAT
GTATTCTGGTTGGGACATTAAAGACTGCAAACGCTGGAGGAATAGCTTGCAGCGGGATTTCACTATTAACAGCTTGTTCT
ATAATCCCTTTGATTTTACAATTTATGACTACGCCAATGGAATGGAAGACTTGACGGATCTTAAGCTTCGTACACTTGTC
CCTGCACATTTATCATTCAAGGAAGATTGTGCTAGAATTCTTAGGGGGTTAAGAATTGCAGCACGATTGGGTCTATCATT
GTCAAAGGATGTTAAGACTGCAATACCTGAATTTGTATCTTCCGTTGCAAATCTGGACCAGTTTAGATTAATCATGGAAA
TGAATTATATGCTTGCGTATGGAGCTGCTGCGCCGTCCATCCTTCTTCTCATGAAGTTCAAACTACTTCATGTGTTACTT
CCTTTTCAGGCAGCTTACCTGGATCAAGCTAGTAAAACATCTCTATCAAGTTCCTTGATGCTAGTGAGGTTATTCTCCAA
TATGGATAAATTGGTTTCCTGCGATCAACCTGCTGACCCCAAACTATGGATTGCAGTGTTGGCTTTTCACATTGCACTAG
TGCGTAACCCCCAAGAGGCTATTGTGGTGCGCGCTTTTGCTGCTTTGCTCTACCATGGAAACTGGAGCAAAGCTGTCGAA
TTTGCTAGAGAACATGAAACTTCAGTGATCGGATACGCTCCTGAGGTATCTAAATCTTCGAGAAAGAGATCTGATGAAGA
TCTTGCAGAAGCAGTTTCAGAATTCACATGTCTATTAAAAGATACTCAATACGTTCTGACTGATAAAGAGGCTCTCCGGG
AAGCCCTATACCTATACCCGGATTTCAAATTCTCTGGTTTGGTGTTTATACCGAAGAAAAAGGGGAGAGATGTAGCAGAA
GGGTTTATGAGATTGAGTGATGTGGAATCATATGAAAGCCAAAAAGAGGGATTCTCTATCGACTATGTCTTGCTTGGGAA
GGGAAATCCATGCGAAGTAAGATTTGTTCTTGGCAAAATCATTCTGGACACCATCACAGAAGGTACCGTCATCGAACCTC
TAAACTCTGTCAAGAAGAAGCAGAGCACCAGAAATCATATTGTTCCAGCGGCTTGCTTGGAGAAGAAGGATGAGTTGTTC
GTTTCTAAATCGTCAAAAGAGGATAACAACAATCAAACTCCAGTCCATGACTCAAATGCATCATCTGTTCTAAAGATTTT
GAAGAGGACGAGAGAAGACAGTGAGCAGAACAATGACCAAGAGACCGAGGTATGTCCAAGAACCCCCTCTGGTCCAGCAA
AGAATCAAGATCAGTCTGTAGTTCAAATGCTTAAAAGACGGCGTAGCAAAGAAGCACCAGTCTCTGAGCCGCCTAAGCAA
AAGACTTCAAAGAGGTCGAGATCAGATGACCAAGAGGCGGTTGGAAGTCTCTCTGTTCCAGCAAAGATTCAGCATCAGAG
TAACAAGCATGACACAAATGCACCGATCTGTGAGCTACCTAAGCAAAAGACTTCAAAGAACCATTCGAAGGAGTCACGAA
AAGTGAAACACAACGACTTGCCTGTGAAGGAGATTAAAGAAGCAAAACAAGGCTTTGTTTCTGACAAATCTATGAGTGAT
CTTCTACAAGTTCTTGAGAAATCAAGTCAGCAAGTGTCTAGCAAAGAGGAGAACAACTCTTTATCATCAGAGAAGACGAA
TAGACCGAGAAAACTCTCAAGTCTCTTCAGGTGA