Details for Arabidopsis Locus AT2G17570

Position : Chr2 ( 5`- 7644053 .. 7646254 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT2G17570

Protein [Map View]
MAELPGQIRHIGGRMSQLLEQIYGFSRRSLFRVISMGPIPCHIAFIMDGNRRYAKKCGLLDGSGHKAGFSALMSMLQYCY
ELGIKYVTIYAFSIDNFRRKPEEVESVMDLMLEKIKSLLEKESIVHQYGIRVYFIGNLALLNDQVRAAAEKVMKATAKNS
RVVLLICIAYNSTDEIVQAVKKSCINKSDNIEASNYKHEDSDSDIEGTDMENQEKKIQLVDIEENMQMSVAPNPDILIRS
SGETRLSNFLLWQTGNTQLCSPAALWPEIGLRHLLWAILNFQRNHSYLEKRKKQL*

DNA
ATGGCTGAACTTCCTGGTCAAATAAGACATATAGGCGGTCGAATGAGTCAACTGCTAGAGCAGATATATGGGTTTTCGAG
AAGATCTTTGTTTCGGGTCATATCTATGGGTCCTATACCTTGTCATATTGCCTTTATCATGGATGGAAATCGGAGATATG
CAAAGAAGTGTGGTCTTTTAGATGGGTCTGGTCACAAAGCGGGGTTTTCTGCGCTTATGTCGATGCTGCAATACTGCTAC
GAGCTGGGTATCAAGTATGTAACGATATACGCATTTAGCATAGATAATTTTAGAAGAAAACCTGAGGAGGTTGAGTCTGT
AATGGATTTGATGCTGGAAAAGATAAAGTCTTTGCTTGAAAAAGAGAGTATTGTGCATCAGTATGGGATTCGGGTCTATT
TTATCGGTAACTTAGCGCTTCTAAATGACCAAGTGAGAGCTGCTGCAGAAAAAGTCATGAAAGCCACAGCTAAGAATAGT
CGGGTAGTGCTTCTCATTTGCATTGCCTATAACTCGACAGATGAGATCGTACAAGCTGTCAAGAAATCTTGTATTAACAA
GTCAGACAATATTGAAGCATCTAATTATAAACACGAGGATAGCGATAGTGATATAGAAGGAACAGATATGGAGAACCAAG
AGAAGAAGATACAGTTGGTGGATATTGAGGAGAATATGCAGATGAGCGTGGCGCCGAATCCTGATATACTCATCAGGAGT
TCAGGAGAGACGAGGCTGAGCAATTTTCTCTTATGGCAAACAGGTAATACCCAGCTCTGCTCTCCGGCTGCTCTGTGGCC
TGAGATTGGTTTGAGGCATCTGCTCTGGGCTATATTGAACTTCCAAAGAAATCATTCATACTTGGAAAAGAGGAAGAAAC
AATTATGA