Details for Arabidopsis Locus AT2G17560

Position : Chr2 ( 5`- 7642165 .. 7643667 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT2G17560

Protein [Map View]
MKGGESKAEATSTDQRLKTRGRKAGKKTKKDPNQPKRPPSAFFVFLEDFRKEFNLANPNNKSVATVGKAAGARWKAMTDE
DKAPYVAKAESRKTEYIKNVQQYNLKLASGTNREEDDSDKSKSEVDEAVSEEEAEDDD*

DNA
ATGAAAGGCGGCGAATCCAAAGCTGAAGCAACGAGCACTGATCAGAGACTCAAAACCAGAGGTAGAAAGGCTGGGAAGAA
GACGAAGAAGGATCCAAATCAACCTAAGAGACCTCCAAGTGCTTTCTTCGTCTTCCTTGAGGATTTCCGAAAAGAGTTTA
ACCTAGCGAATCCTAATAACAAATCCGTCGCTACTGTTGGTAAGGCTGCTGGAGCTAGATGGAAGGCAATGACTGATGAA
GATAAAGCTCCTTACGTCGCTAAGGCTGAGAGCAGAAAGACTGAATATATTAAGAATGTGCAACAGTACAACTTGAAACT
GGCTAGTGGAACCAATAGAGAAGAGGATGACTCTGACAAATCCAAGTCTGAAGTTGATGAAGCAGTAAGCGAAGAGGAGG
CAGAAGACGACGATTGA