Details for Arabidopsis Locus AT2G17540

Position : Chr2 ( 5`- 7630420 .. 7631912 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT2G17540

Protein [Map View]
MATNACLESDSLLPPRKRLLAGFKNQNSRISNESPSPPFASSSSSTTTSNGSSASAVVHTHHLDHLLNDQTRSPEELAQA
SKATAALAVKVAKAARATANEKAIIASKAVAAAKNALELFASFPAAETVSCKEPRLIRAINNSPRVLTDCSGHRNKKQKT
LTSTMNDGNDVAGVVDSDDGTRVNGKLLLCDNTLKEKTEEESSSLGKRRGRVKLPLSMCAYKDQENGITLEENNLSVSKS
EGYNGGVAQVIERPSWKCQDLKSPECVKQNKVVRS*

DNA
ATGGCGACAAATGCGTGCCTTGAGTCCGATTCGCTTCTACCTCCACGGAAGCGTTTACTCGCCGGATTCAAGAACCAGAA
CTCGAGAATCAGCAATGAATCTCCGAGTCCTCCTTTCGCTTCTTCGTCCTCGTCTACTACAACTTCAAATGGTTCCTCTG
CTTCAGCAGTTGTGCACACTCATCATCTCGACCATCTACTCAATGACCAGACTCGGTCCCCGGAAGAGCTTGCTCAGGCG
TCGAAAGCAACCGCTGCTTTAGCGGTTAAGGTTGCAAAGGCGGCGAGAGCTACTGCTAATGAGAAGGCCATCATTGCTTC
TAAAGCAGTGGCTGCAGCCAAGAATGCGTTGGAATTGTTTGCTTCTTTTCCCGCAGCTGAGACGGTTTCTTGTAAAGAGC
CTAGGTTGATTCGAGCTATAAACAATTCTCCTAGAGTCTTGACGGATTGTTCTGGTCACAGAAACAAGAAGCAAAAGACT
CTGACTAGTACTATGAACGATGGGAATGATGTTGCTGGTGTTGTGGATTCAGATGACGGAACCAGAGTAAACGGGAAGCT
GCTCTTATGCGATAACACGCTAAAGGAGAAAACAGAGGAAGAGAGTAGCTCATTAGGGAAAAGAAGAGGAAGAGTGAAGC
TCCCTTTGAGCATGTGTGCCTACAAGGATCAAGAAAACGGTATCACATTAGAGGAAAACAATCTAAGTGTAAGTAAGTCG
GAAGGTTATAATGGTGGTGTGGCTCAGGTTATAGAACGACCATCATGGAAGTGTCAGGACTTAAAGTCACCGGAATGTGT
GAAGCAGAACAAAGTTGTACGTTCATAG