Details for Arabidopsis Locus AT2G03520

Position : Chr2 ( 5`- 1069491 .. 1071382 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT2G03520

Protein [Map View]
MYVVESKAGAIGCMILSLCCLGSWPAILTLLERRGRLPQHTFLDFATANLLAAIVIAFSLGEIGKSTFLKPDFTTQLPQD
NWPSVLLAVAGGVLLSIGNLATQYAFAFVGLSVTEVITASITVVIGTTLNYFLDNKINKAEILFPGVGCFLIAVFLGAAV
HASNAADVKEKLKSLPSEDLYSSIENGEDKPEIEKTDVESQEKLAEKAKAGTAGFYVELENKRAIKVFGKSIMIGLFITL
FAGISLSLFSPAFNLATNDQWSTLPKGVPKLVVYTAFFYFSIAGFLISLILNLIFLYRPMVGLARSSLKKYIYDSKGRGW
AVFAGFLCGFGNGLQFMGGQAAGYAAADSVQALPLVSTFWGIVLFGEYRKSSKRTYALLVSMLAMFVAAVAILMASSGHR
K*

DNA
ATGTATGTGGTTGAGAGCAAAGCAGGAGCTATAGGATGTATGATACTCTCATTGTGTTGTTTGGGAAGTTGGCCAGCGAT
TCTGACTCTATTGGAGAGAAGAGGTCGTCTTCCTCAACACACGTTTCTTGATTTCGCAACCGCGAATCTCTTGGCTGCAA
TCGTGATAGCATTTTCGCTCGGTGAGATTGGGAAAAGCACGTTTCTAAAACCTGACTTTACCACTCAGCTACCTCAGGAT
AATTGGCCGTCGGTATTGCTTGCAGTCGCAGGCGGTGTGCTTCTTAGCATCGGGAATTTAGCGACTCAATACGCTTTTGC
GTTTGTCGGTTTATCGGTTACTGAAGTTATAACCGCAAGCATTACCGTCGTCATTGGTACAACATTGAATTATTTCTTGG
ACAACAAGATAAACAAAGCCGAGATCCTCTTCCCTGGCGTAGGTTGCTTCTTGATCGCTGTTTTCCTAGGCGCTGCGGTT
CATGCTTCTAATGCAGCTGATGTCAAAGAGAAACTCAAGTCTTTACCTAGCGAAGATTTATATTCTTCTATTGAAAATGG
TGAAGACAAGCCTGAAATAGAGAAAACTGATGTCGAATCTCAAGAGAAACTCGCGGAAAAGGCGAAAGCAGGGACGGCAG
GATTCTATGTAGAGCTAGAGAACAAAAGAGCAATCAAGGTCTTTGGAAAAAGCATAATGATCGGACTATTCATAACGCTG
TTCGCGGGAATCAGCCTTTCTCTATTCTCTCCTGCATTCAACTTGGCAACAAACGATCAATGGAGTACATTGCCAAAAGG
CGTACCTAAGCTCGTTGTCTATACCGCCTTTTTCTACTTCTCAATCGCGGGTTTTCTCATTTCTTTGATTCTAAACCTCA
TCTTTCTTTACCGGCCAATGGTAGGCTTAGCGAGATCATCGCTTAAGAAGTATATATATGACTCCAAAGGTAGAGGTTGG
GCGGTTTTCGCTGGATTCTTGTGCGGGTTTGGTAACGGTTTGCAGTTCATGGGAGGTCAAGCCGCTGGATACGCGGCTGC
AGACTCTGTCCAGGCACTTCCTCTTGTAAGCACATTTTGGGGTATAGTTTTGTTCGGAGAGTATCGAAAATCGTCGAAGC
GAACTTATGCCCTTTTAGTTAGCATGTTGGCCATGTTTGTGGCGGCCGTAGCTATTCTTATGGCCTCTTCCGGTCACCGG
AAATGA