Details for Arabidopsis Locus AT2G03505

Position : Chr2 ( 5`- 1064236 .. 1065372 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT2G03505

Protein [Map View]
MRLLLSLLFLLALTTYSSATYCLCRDGVGEKDLQTSIDYACGVLKDCNPIHEKGPCYQPNTIKSHCDWAVNTYFQRFGQI
SGSCNFSGTATTSQNLPSTVVTGCLYPSSPGSAGTTPTTGTPSGTQTFPGPPAFGPAGDFDPSGNNGAPSLFISIALSLG
FSVVIAFL*

DNA
ATGAGATTGCTTCTTAGTCTCTTGTTTCTCTTGGCTTTAACCACCTACTCAAGTGCAACTTATTGTCTATGTAGAGATGG
TGTTGGAGAGAAAGATCTTCAAACATCGATAGATTATGCATGTGGAGTTTTAAAAGATTGTAATCCTATTCATGAGAAAG
GTCCTTGTTATCAACCAAACACCATCAAGAGTCATTGTGATTGGGCGGTTAATACTTATTTCCAAAGATTTGGTCAAATC
TCTGGAAGCTGTAATTTCTCAGGAACTGCTACTACCAGCCAAAATCTTCCTTCAACTGTGGTTACTGGTTGCTTATATCC
TTCAAGTCCAGGAAGTGCAGGGACAACTCCCACGACAGGTACTCCTTCAGGAACACAGACGTTTCCGGGACCTCCTGCGT
TTGGTCCGGCCGGAGATTTTGATCCTTCAGGCAATAATGGTGCTCCGAGTTTGTTCATTTCAATCGCTCTCTCACTTGGT
TTCTCCGTCGTCATTGCGTTTCTATAA