Details for Arabidopsis Locus AT2G03470

Position : Chr2 ( 5`- 1045452 .. 1047684 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT2G03470

Protein [Map View]
MGLKRPYDAEEMQKCNAKHARQLSYKNHNQFDEAIPYHHASMEKKTNVLVEDLIGLCENPTWTNDANHVDKGFETTGLCQ
EDSQSGVTTQSDLSHQSSGSDFTWKPVEDVYTCLMNQPPRKQVLVGSNHQADIPEFVKEEILDQSEARTKEDLEGKLMRK
CVIPMSDSDLCGTGQGRKECLCLDKGSIRCVRRHIIEARESLVETIGYERFMELGLCEMGEEVASLWTEEEEDLFHKVVY
SNPFSAGRDFWKQLKGTFPSRTMKELVSYYFNVFILRRRGIQNRFKALDVDSDDDEWQVEYNIFNSTKSLDEEDNNGNRS
SYEDNEEEEETSSNDDDEEEEEEDDSSSNDAHCVDTDKASRDGFGEEVNVEDDSCMSFELQDSNLIFSHNPIKNRECHRS
GEDSYSFDDQRFTSDCWNKNNDLLPTSNIIEEIFGQDDWGDKDDNNLKEK*

DNA
ATGGGATTAAAGCGACCTTATGATGCTGAAGAGATGCAAAAGTGCAATGCTAAGCATGCAAGACAGCTTAGTTACAAAAA
CCATAACCAATTTGACGAAGCTATTCCATATCATCATGCTTCTATGGAGAAGAAGACAAATGTTTTAGTAGAGGATCTGA
TTGGTCTCTGTGAGAATCCTACGTGGACTAATGATGCAAATCACGTTGACAAGGGTTTTGAAACAACCGGTTTGTGTCAG
GAAGATTCTCAGTCTGGAGTGACGACTCAGTCAGATCTTTCTCATCAATCTTCTGGTTCAGATTTCACCTGGAAGCCAGT
GGAAGATGTTTATACTTGTTTGATGAATCAACCTCCTAGGAAACAAGTTCTTGTTGGGTCTAATCATCAAGCGGATATTC
CCGAGTTTGTCAAGGAAGAGATTCTTGATCAGTCAGAGGCTCGAACTAAGGAGGACTTAGAAGGGAAGCTGATGAGAAAG
TGTGTGATACCAATGTCTGACTCTGACCTTTGTGGAACCGGTCAAGGAAGAAAGGAATGTCTTTGCCTAGATAAAGGCTC
TATTAGATGTGTGCGGCGACATATCATTGAAGCCAGAGAGAGTTTGGTTGAAACTATTGGATATGAAAGGTTTATGGAGC
TAGGGTTATGTGAGATGGGGGAGGAAGTTGCGAGTTTATGGACAGAGGAAGAAGAAGATCTCTTTCACAAGGTTGTATAC
TCCAATCCTTTCTCAGCGGGTCGTGACTTCTGGAAGCAATTAAAGGGAACGTTTCCTTCAAGAACCATGAAGGAGTTGGT
TAGCTACTACTTCAATGTCTTCATCTTGCGGAGACGGGGTATTCAGAATCGGTTCAAAGCCCTAGATGTTGACAGTGATG
ATGACGAGTGGCAAGTTGAATACAACATTTTTAACAGCACCAAATCTTTAGATGAGGAAGACAACAATGGAAATCGCTCC
TCATATGAAGATAACGAGGAAGAAGAAGAAACCAGCAGCAATGATGATGATGAAGAAGAAGAAGAGGAAGACGACTCATC
AAGTAACGATGCTCATTGTGTAGATACGGATAAGGCTTCAAGAGACGGTTTTGGTGAAGAAGTAAATGTGGAAGACGACT
CATGTATGTCCTTCGAGTTACAAGACTCCAACTTGATCTTCAGTCACAACCCAATCAAAAACAGAGAGTGCCACAGATCT
GGTGAAGATTCATATTCATTTGATGATCAGAGATTCACATCAGATTGTTGGAACAAGAACAACGATCTACTACCAACTTC
AAACATTATTGAGGAGATATTTGGTCAAGACGATTGGGGAGATAAAGATGATAATAACTTGAAGGAGAAGTAA