Details for Arabidopsis Locus AT2G03290

Position : Chr2 ( 5`- 999422 .. 1000606 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT2G03290

Protein [Map View]
MDLCRSSILLLIIALLSPRTLSMRYELKSSKTKCIGEEIHENAMSIGKYFIVNPNEDNHPLPDSHKIIVKVMPPQGKNLH
EADKVEAGQFSFTAYENGSYVACITAIDYKPETTLTIDFDWKTGVHSKEWTNVAKKSQVDMMEYQVKTLMDTVISIHEEM
YYLREREEEMQELNRSTNSKMAWLSFGSLVVCLSVAGLQFWHLKTFFEKKKLI*

DNA
ATGGATCTTTGTCGAAGCTCGATTTTGCTTTTGATCATTGCGTTGTTATCTCCTAGGACACTATCAATGCGTTACGAACT
AAAGTCTTCGAAAACGAAATGTATCGGAGAGGAGATTCACGAAAACGCCATGTCCATTGGTAAATACTTCATCGTAAACC
CTAACGAAGATAATCATCCTCTTCCTGATTCTCACAAGATCATCGTCAAGGTGATGCCACCACAAGGGAAGAATTTGCAC
GAAGCCGATAAGGTAGAGGCTGGTCAGTTCTCGTTTACTGCTTATGAAAATGGGAGTTACGTAGCGTGCATCACTGCCAT
TGATTATAAGCCGGAGACCACGTTGACTATTGATTTTGATTGGAAGACTGGTGTTCACTCTAAGGAGTGGACCAATGTGG
CTAAGAAGAGTCAAGTTGATATGATGGAGTATCAGGTTAAGACCTTGATGGATACTGTTATTTCCATACATGAGGAGATG
TATTATCTTCGTGAAAGGGAAGAGGAAATGCAAGAACTGAATAGATCCACAAACTCGAAGATGGCGTGGTTGAGTTTCGG
GTCGCTTGTGGTTTGTTTATCGGTGGCTGGTCTACAATTCTGGCACTTGAAAACTTTCTTTGAGAAAAAGAAACTCATCT
AA