Details for Arabidopsis Locus AT2G03240

Position : Chr2 ( 5`- 973413 .. 977337 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT2G03240

Protein [Map View]
MKFGKEFSSQMVPEWHEAYMDYDYLKSQLKEIIKFKRKTNPHGPHHHHHHLLHRKMTLHRAFSGLISTSPKKKKHHGHGG
GHGGGHQIGHFSDSDDDIEEGIKHVTAPILINSASHGYETTFLMASEEGGEYETVFFRRLDDEFNKVEKFYKEKVEEVMK
EAVMLEKQMDALIAFRVKVEHPDGWPWEERTVEMTQLASDVANSAAAVAASTPAGARSMKVGAQAHMEAIQEGGSSKAGK
SSDEEDDDDAEKEEDNGVSGEVSGDVRKMKAGRPPPIEVLDRVKFNHTKETPRSTIKSVLQASNLTELKFSRENLRKVEA
KLRRAFVEFYQKLRLLKSYSFLNELAFSKILKKYDKITSRHASKSYMKMIDNSYLGSSDEVTRLVERVEATFIKHFSNAN
RSKGMNILRPKAKRERHRITFSTGFLGGCLFSLVVALFAIIRTRNILQEEGQKQYMNTMFPLYSLFGFVVLHILMYAGNI
YYWRRYRVNYSFIFGFKHGTELGYRQVLFVGLSIGVFALLCILANLDMEVDPETKDYQALTELLPLFLLTGMFVVLVLPF
NIFYRSSRFFFLTCLFHCLAAPLYKVTLPDFLVGDQLTSQVQALRSIQFYICHYGWGDYKHRINTCTESDAYNAFLFIVA
VIPYVSRLLQCLRRLFEEKNPEQGYNGLKYFLTIVAVCLRTTYSVDEDNQFIWRILAGIFSAIAAIFCTYWDLVYDWGLL
NRTSKNPWLRDKLLVPQKKVYFIAMILNILLRFAWLQTVLDFNFSFMHRQTMVAVVASLEIIRRGIWNFFRLENEHLNNV
GKYRAFKTVPLPFNYDEDDDKGN*

DNA
ATGAAGTTCGGGAAAGAGTTCTCGTCGCAAATGGTGCCGGAATGGCATGAAGCTTACATGGATTATGATTATCTCAAATC
TCAACTTAAAGAAATCATCAAATTCAAACGCAAAACCAATCCTCACGGTCCTCATCATCATCATCATCACTTACTTCACA
GGAAAATGACTCTTCACCGAGCATTCAGCGGTTTAATCTCCACATCACCGAAAAAAAAGAAACACCACGGACACGGCGGC
GGACACGGTGGTGGTCATCAGATCGGACATTTCTCAGATTCCGATGATGACATCGAGGAGGGAATTAAGCATGTCACTGC
GCCGATTCTAATAAACTCGGCGAGTCATGGTTACGAGACGACGTTTTTGATGGCGTCGGAGGAAGGAGGAGAGTACGAGA
CGGTGTTTTTCCGGCGACTAGACGATGAGTTCAATAAAGTTGAGAAGTTTTATAAAGAGAAAGTTGAAGAAGTTATGAAA
GAAGCTGTGATGCTTGAGAAGCAAATGGATGCTTTAATTGCGTTTAGGGTTAAAGTTGAACATCCTGATGGTTGGCCTTG
GGAGGAACGTACGGTGGAGATGACTCAATTAGCTTCTGATGTTGCTAATTCTGCGGCGGCCGTCGCTGCTTCTACTCCCG
CCGGTGCTAGATCTATGAAAGTTGGAGCTCAAGCTCACATGGAAGCGATACAAGAAGGAGGATCAAGCAAAGCTGGTAAA
TCCTCTGACGAAGAAGATGATGATGATGCAGAGAAAGAAGAAGATAACGGTGTTTCCGGCGAAGTGTCCGGTGACGTGAG
GAAGATGAAAGCTGGGAGACCACCTCCGATTGAGGTTTTGGATCGTGTCAAGTTTAACCATACGAAGGAAACGCCACGAT
CCACCATTAAAAGTGTTCTCCAGGCCTCGAATTTGACGGAGCTTAAATTTAGCAGAGAGAATCTGAGGAAAGTGGAGGCG
AAACTCAGACGCGCCTTCGTTGAGTTTTACCAGAAGCTTCGGTTACTCAAAAGCTACAGCTTTTTGAATGAATTAGCGTT
TTCGAAGATATTGAAGAAATATGATAAGATAACTTCAAGGCATGCTTCAAAGTCTTACATGAAAATGATTGATAACTCTT
ACCTTGGAAGCTCTGATGAGGTTACTAGACTCGTTGAGCGTGTTGAAGCTACGTTTATTAAGCATTTCTCCAATGCTAAC
AGATCAAAAGGAATGAACATCTTGAGACCCAAAGCTAAACGAGAGAGACATCGAATTACATTCTCCACAGGTTTCTTGGG
TGGATGTTTGTTTTCTCTAGTAGTGGCTCTATTCGCAATCATACGAACACGAAACATTTTGCAGGAGGAAGGCCAGAAAC
AGTACATGAACACTATGTTCCCTCTTTACAGTTTGTTCGGGTTCGTCGTTCTGCACATACTTATGTATGCTGGTAACATA
TACTACTGGAGGCGGTATCGAGTGAATTACTCTTTCATATTTGGGTTCAAGCACGGTACTGAACTTGGTTATAGACAAGT
TCTATTTGTGGGATTAAGCATTGGAGTCTTTGCACTTCTTTGTATTCTTGCCAATCTTGACATGGAGGTTGACCCCGAAA
CTAAAGATTATCAAGCATTAACCGAACTTCTTCCTCTTTTCCTGCTCACTGGTATGTTTGTAGTTCTAGTCTTACCATTC
AACATCTTCTACCGGTCGAGTCGCTTCTTCTTCCTCACTTGCCTCTTTCACTGCCTTGCTGCTCCTCTATACAAGGTAAC
ATTACCTGATTTCTTGGTGGGCGATCAGTTAACAAGTCAGGTGCAAGCTCTTCGAAGTATCCAGTTTTATATATGTCATT
ACGGTTGGGGAGATTACAAACATCGAATAAACACTTGCACAGAGTCAGATGCCTACAATGCTTTCTTATTCATTGTTGCT
GTCATCCCATACGTCTCTCGTCTCCTTCAGTGCTTGAGGCGACTGTTTGAAGAGAAAAACCCAGAACAAGGATACAATGG
CCTCAAGTACTTCTTGACTATAGTGGCTGTCTGCTTGAGGACGACTTACAGTGTCGACGAGGATAATCAATTTATATGGA
GAATATTAGCTGGGATCTTCTCAGCTATTGCTGCCATTTTCTGTACTTACTGGGACTTAGTCTATGACTGGGGTCTTCTA
AACAGAACATCTAAGAACCCTTGGCTCCGTGATAAACTCCTTGTCCCGCAGAAGAAAGTATACTTCATCGCGATGATCTT
GAACATCTTGCTCAGGTTCGCGTGGCTGCAGACCGTGCTTGATTTCAATTTCTCCTTCATGCACAGACAGACGATGGTTG
CTGTTGTTGCCAGTCTAGAGATTATCCGCCGTGGGATATGGAATTTCTTCAGGTTAGAGAATGAGCATTTGAACAATGTT
GGGAAGTATCGAGCATTTAAGACGGTTCCATTACCGTTTAACTACGACGAGGATGACGATAAAGGCAACTAG