Details for Arabidopsis Locus AT2G03090

Position : Chr2 ( 5`- 916854 .. 918643 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT2G03090

Protein [Map View]
MFMGKMGLLGIALFCFAAMVCSVHGYDAGWVNAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCG
ACFEIKCQSDGAWCLPGAIIVTATNFCPPNNALPNNAGGWCNPPLHHFDLSQPVFQRIAQYKAGVVPVSYRRVPCMRRGG
IRFTINGHSYFNLVLVTNVGGAGDVHSVAVKGSRTRWQQMSRNWGQNWQSNNLLNGQALSFKVTASDGRTVVSNNIAPAS
WSFGQTFTGRQFR*

DNA
ATGTTCATGGGTAAGATGGGTCTTTTGGGAATTGCTCTGTTTTGTTTTGCTGCAATGGTGTGCTCTGTTCATGGCTATGA
CGCTGGATGGGTCAATGCTCATGCTACCTTCTATGGTGGAAGTGATGCTTCAGGAACAATGGGTGGAGCTTGTGGCTACG
GGAACCTCTACAGTCAAGGTTACGGGACCAACACGGCGGCGTTGAGCACTGCTCTGTTCAACAACGGTCTTAGCTGCGGG
GCTTGTTTTGAGATCAAGTGTCAGAGCGACGGCGCGTGGTGTTTACCTGGTGCTATCATTGTCACAGCCACCAATTTCTG
TCCTCCTAACAACGCTCTTCCCAATAACGCTGGTGGTTGGTGTAACCCTCCGCTTCATCATTTCGATCTCTCTCAGCCTG
TTTTTCAACGCATTGCTCAGTACAAAGCTGGTGTTGTCCCTGTTTCCTACAGAAGGGTTCCGTGTATGAGAAGAGGAGGT
ATAAGATTCACAATCAACGGTCACTCTTACTTCAACCTTGTCTTGGTGACCAATGTTGGTGGTGCTGGAGATGTTCATTC
GGTTGCGGTTAAAGGTTCTAGAACAAGGTGGCAACAAATGTCAAGAAACTGGGGACAGAACTGGCAAAGCAACAATCTCT
TAAACGGTCAAGCATTGTCATTTAAGGTGACTGCTAGTGATGGTCGTACCGTCGTCTCTAACAACATTGCTCCAGCTAGT
TGGTCCTTTGGACAAACCTTCACCGGCCGTCAATTCCGTTAA