Details for Arabidopsis Locus AT1G79720

Position : Chr1 ( 5`- 29997127 .. 29999045 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G79720

Protein [Map View]
MFKKATLNLSLAPLLLVFLFLLSCVVHGVDEKKILSVHNNIWSPKKSYEASTSCFSRSLGKGRESTTLEMKHRELCSGKT
IDLGKKMRRALVLDNIRVQSLQLKIKAMTSSTTEQSVSETQIPLTSGIKLESLNYIVTVELGGKNMSLIVDTGSDLTWVQ
CQPCRSCYNQQGPLYDPSVSSSYKTVFCNSSTCQDLVAATSNSGPCGGNNGVVKTPCEYVVSYGDGSYTRGDLASESILL
GDTKLENFVFGCGRNNKGLFGGSSGLMGLGRSSVSLVSQTLKTFNGVFSYCLPSLEDGASGSLSFGNDSSVYTNSTSVSY
TPLVQNPQLRSFYILNLTGASIGGVELKSSSFGRGILIDSGTVITRLPPSIYKAVKIEFLKQFSGFPTAPGYSILDTCFN
LTSYEDISIPIIKMIFQGNAELEVDVTGVFYFVKPDASLVCLALASLSYENEVGIIGNYQQKNQRVIYDTTQERLGIVGE
NCRV*

DNA
ATGTTCAAGAAAGCAACATTGAATCTTTCACTTGCTCCTTTGCTACTTGTTTTTCTTTTCCTTCTCTCGTGTGTTGTTCA
TGGCGTCGATGAGAAGAAGATTCTCAGTGTACATAACAACATCTGGTCTCCCAAGAAATCATACGAAGCTTCAACTTCAT
GTTTTTCTCGCAGTCTTGGAAAAGGAAGAGAATCCACTACATTGGAGATGAAACATAGAGAACTTTGCTCAGGAAAGACT
ATAGATTTGGGTAAGAAGATGAGAAGAGCCTTAGTTTTGGATAACATTCGAGTTCAGTCACTTCAACTCAAAATCAAAGC
AATGACCTCAAGCACCACTGAACAATCTGTTTCCGAAACTCAGATTCCGTTAACCTCAGGGATAAAACTTGAGTCTTTGA
ACTACATCGTTACAGTTGAATTAGGAGGGAAAAACATGAGTTTGATCGTTGACACTGGAAGTGACCTGACTTGGGTCCAA
TGCCAGCCTTGCAGATCCTGTTACAACCAACAAGGTCCTTTGTATGACCCATCAGTCTCATCTTCTTACAAGACGGTGTT
CTGTAACTCATCCACTTGTCAGGACCTTGTGGCAGCTACCAGCAATTCCGGCCCTTGTGGAGGTAACAATGGTGTTGTAA
AGACACCTTGTGAGTACGTTGTCAGCTATGGAGATGGATCATACACTCGAGGAGACTTGGCAAGTGAAAGCATCCTATTG
GGCGACACAAAACTTGAAAACTTTGTCTTTGGTTGTGGCCGAAACAACAAAGGTCTGTTTGGGGGATCCTCTGGTTTAAT
GGGTTTGGGAAGAAGTTCAGTCTCTTTAGTCTCCCAAACTTTGAAAACTTTCAACGGAGTTTTCTCATACTGTTTACCTT
CTCTTGAGGATGGAGCTTCTGGCTCATTGTCCTTTGGTAACGATTCCTCTGTTTACACGAATTCAACTTCAGTTTCCTAC
ACGCCGTTAGTACAAAACCCTCAGCTTCGTTCCTTTTACATTCTGAATCTCACTGGTGCTAGCATTGGTGGCGTGGAACT
GAAATCTTCAAGCTTTGGCAGAGGGATTCTAATCGATTCAGGAACGGTTATCACAAGATTGCCACCTTCCATTTACAAAG
CTGTGAAGATAGAGTTTCTGAAACAGTTTTCCGGGTTTCCTACTGCTCCTGGTTATTCAATCTTAGACACTTGCTTTAAC
CTCACAAGTTATGAAGACATAAGCATTCCCATTATCAAAATGATCTTCCAAGGTAACGCTGAGCTCGAAGTGGATGTCAC
TGGTGTGTTCTACTTTGTCAAGCCTGACGCATCTCTAGTCTGCTTGGCCTTAGCAAGTCTGTCATATGAAAATGAAGTCG
GGATCATCGGAAATTATCAGCAGAAAAACCAGAGAGTAATATATGATACCACACAAGAGAGGCTAGGAATTGTCGGAGAA
AACTGCAGAGTCTGA