Details for Arabidopsis Locus AT1G79710

Position : Chr1 ( 5`- 29995116 .. 29998058 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G79710

Protein [Map View]
MANRSEEAEYENDSRRNHQDKKKEGVLDLVLKRPLRWLRMLIEELHWSFFFGVIIVYGVSQGLGKGLSKVSTQYYFKDEQ
KIQPSQAQIYVGLIQIPWIIKPLWGLLTDVVPVLGYRRRPYFILAGFLAMISMMVLWLHTNLHLALALSCLVAGSAGVAI
ADVTIDACVTQCSISHPTLAADMQSLCGLCSSIGSLVGFSLSGVLVHLVGSKGVYGLLGVTAGLLVVVGMVLKESPSRSL
GRKHVNDKFLDAGSAIWKTFQYGEVWRPCLFMLLSAAVSLHIHEGMFYWYTDSKDGPSFSKEAVGSIMSFGAIGSLVGIL
LYQNFLKNFPFRNVVFWALSLSVLSGFLDLILVLRINLKLGLPDYFFIVVDEFVSHMISRIKWLPLLVLSSKLCPAGMEG
TFFALLMSIEHIGHLVSSWGGGVLLHALKVTRTQFDNLWLVIVIRSLLRVIPIGLVFLIPNVDSNSTILPAEMLTSRISE
GVDTEKIEMTALISDEA*

DNA
ATGGCCAATCGATCGGAGGAAGCAGAGTACGAGAACGATTCTCGGCGAAATCATCAAGACAAGAAGAAAGAAGGAGTTTT
AGATCTGGTACTGAAACGACCTTTACGGTGGCTAAGAATGCTCATCGAAGAGCTTCACTGGAGCTTCTTCTTCGGTGTGA
TTATCGTCTATGGAGTTAGCCAAGGACTTGGTAAAGGTCTCAGCAAAGTCAGCACACAGTACTACTTCAAAGACGAGCAG
AAGATACAACCCTCTCAAGCTCAGATTTACGTTGGTTTGATTCAGATTCCTTGGATTATTAAACCTCTCTGGGGATTGTT
GACTGATGTTGTCCCAGTTTTGGGTTACAGGAGACGACCCTATTTCATATTAGCCGGTTTTCTTGCTATGATCTCCATGA
TGGTGTTATGGCTTCACACGAATCTGCATCTTGCACTGGCTTTGTCCTGTCTTGTGGCAGGAAGTGCTGGAGTTGCTATA
GCAGATGTAACTATTGATGCTTGTGTGACACAATGTAGCATAAGCCATCCTACACTTGCTGCAGATATGCAAAGTTTGTG
TGGTTTGTGTTCTTCGATTGGTTCCTTGGTTGGTTTCTCCCTTAGCGGCGTTTTGGTGCACTTGGTTGGGTCCAAAGGTG
TGTACGGTTTACTCGGTGTGACGGCAGGATTGCTTGTTGTGGTTGGGATGGTTCTGAAAGAATCTCCTTCTCGCAGTCTA
GGTCGCAAGCATGTTAACGACAAGTTTCTGGATGCTGGAAGTGCAATATGGAAAACCTTTCAATATGGTGAGGTGTGGCG
ACCATGCTTGTTCATGCTATTGTCAGCTGCAGTGAGCTTGCACATTCACGAAGGCATGTTCTATTGGTACACGGATTCAA
AGGATGGCCCTTCCTTTTCAAAGGAAGCCGTTGGATCCATTATGTCGTTTGGTGCAATTGGCTCTCTTGTGGGAATACTT
CTCTATCAGAACTTTCTGAAGAACTTCCCTTTCAGGAATGTCGTCTTCTGGGCACTTTCCCTATCTGTCCTGTCAGGATT
TCTGGATTTAATCCTGGTGCTGCGCATAAATCTGAAGCTTGGTCTCCCTGATTACTTCTTTATTGTGGTAGATGAGTTTG
TTTCACATATGATAAGTAGAATCAAGTGGTTACCCTTACTTGTTCTCAGCTCCAAGCTCTGCCCTGCCGGTATGGAAGGC
ACTTTCTTTGCTTTGCTCATGTCTATTGAACATATAGGACATCTAGTGTCGTCATGGGGCGGAGGAGTACTACTCCATGC
CCTGAAAGTTACGCGTACTCAGTTTGATAATCTCTGGTTGGTTATTGTGATCAGGAGTTTATTGAGGGTAATCCCAATTG
GATTGGTCTTTTTGATACCAAATGTTGATTCAAACTCAACCATTCTCCCTGCTGAGATGTTAACAAGTAGAATAAGTGAA
GGTGTTGATACCGAGAAGATAGAGATGACCGCTCTGATCAGTGATGAAGCTTGA