Details for Arabidopsis Locus AT1G79660

Position : Chr1 ( 5`- 29975863 .. 29976773 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G79660

Protein [Map View]
MVLDGIVSSPLRRPHALKKQWDDLGSCSTVVQRHRFLLTAMLLLAFLCTIYIYFAVTLGARHLLCSGMTGKDKAMCQMEH
IQASFSNGKLKFF*

DNA
ATGGTTCTTGATGGGATTGTATCATCACCATTACGGAGGCCACATGCTCTTAAGAAGCAATGGGATGACTTGGGTAGCTG
CTCTACTGTTGTCCAGAGGCATCGTTTCCTTTTGACTGCTATGCTTCTTTTGGCATTCCTCTGCACCATTTATATCTACT
TTGCCGTCACACTAGGCGCTAGGCACTTGTTGTGCTCAGGGATGACTGGAAAAGACAAGGCAATGTGTCAAATGGAACAC
ATCCAAGCCAGTTTCTCCAACGGAAAACTGAAATTCTTCTAG