Details for Arabidopsis Locus AT1G79610

Position : Chr1 ( 5`- 29952873 .. 29957189 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G79610

Protein [Map View]
MSSELQISPAIHDPQGQEKQQQAAGVGILLQIMMLVLSFVLGHVLRRHKFYYLPEASASLLIGLIVGGLANISNTETSIR
TWFNFHDEFFFLFLLPPIIFQSGFSLQPKPFFSNFGAIVTFSVLGTFVASMVTGLLVYLGGVMFLMYRLPFVECLMFGSL
ISATDPVTVLSIFQELGSDVNLYALVFGESVLNDAMAISLYRTMSLVRSHSSGQNFFMVIVRFLETFVGSMSAGVGVGFT
SALLFKYAGLDVDNLQNLECCLFVLFPYFSYMLAEGLSLSGIVSILFTGIVMKHYTYSNLSANSQRFVSAFFHLISSLAE
TFVFIYMGFDIAMEKHSWSHLGFIFFSILFIVIARAANVFGCGYLVNLARPAHRKIPMTHQKALWYSGLRGAMAFALALQ
SVHDLPEGHGQTIFTATTAIVVLTVLLIGGSTGTMLEALEVVGDSHDTSLGDGFEVVNSRYMTSYDDEDTPPGSGFRTKL
REFHKSAASFTELDRNYLTPFFTSNNGDYDDEGNMEQHHEERIPFTRRGNLNNRG*

DNA
ATGTCGTCGGAGCTGCAGATTTCGCCGGCGATTCACGACCCGCAAGGTCAAGAGAAGCAGCAGCAAGCCGCCGGAGTCGG
GATTTTGCTTCAGATCATGATGCTTGTCCTCTCTTTTGTACTCGGTCATGTCCTTCGCCGTCATAAGTTCTATTATCTAC
CTGAAGCTAGTGCTTCTCTTCTAATTGGGCTGATCGTTGGTGGTTTAGCGAACATCTCGAACACGGAGACTAGCATAAGG
ACATGGTTCAATTTCCACGATGAGTTCTTCTTTCTGTTTCTGCTGCCTCCCATCATATTCCAGTCAGGCTTCAGTTTACA
ACCTAAACCTTTCTTCTCAAACTTTGGAGCCATTGTCACTTTTTCAGTGCTTGGAACTTTTGTAGCTTCCATGGTTACTG
GATTGCTTGTGTACCTTGGCGGTGTGATGTTTCTCATGTACAGACTTCCATTCGTCGAGTGTCTCATGTTTGGCTCTCTT
ATCTCAGCCACTGATCCTGTCACTGTATTGTCGATATTTCAGGAACTTGGTTCAGATGTAAATTTGTATGCCCTGGTGTT
TGGAGAATCAGTTTTAAATGATGCTATGGCGATATCTCTGTACAGGACAATGTCCTTGGTGAGAAGTCATTCCTCTGGAC
AGAATTTCTTTATGGTGATAGTCAGGTTTCTCGAAACGTTTGTCGGTTCAATGTCTGCAGGCGTTGGAGTTGGATTCACC
TCTGCTCTCCTATTCAAGTATGCAGGACTGGATGTTGACAATCTACAGAACTTGGAGTGCTGTCTCTTCGTACTTTTTCC
ATATTTCTCTTACATGCTTGCTGAAGGTCTCAGTCTATCTGGCATCGTATCGATTCTATTTACAGGGATTGTCATGAAAC
ATTATACCTACTCAAACTTGTCTGCAAATTCTCAGCGATTTGTGTCTGCATTTTTCCATCTGATATCTTCACTGGCAGAG
ACATTTGTGTTCATCTACATGGGTTTTGATATTGCCATGGAAAAGCATAGTTGGTCACACTTGGGATTCATATTTTTTTC
TATTTTATTTATCGTAATTGCAAGGGCAGCTAATGTGTTTGGTTGTGGATATTTGGTCAATCTGGCACGACCTGCTCATA
GGAAAATACCAATGACACATCAAAAAGCACTTTGGTACAGTGGACTTCGAGGTGCTATGGCATTTGCTCTTGCTCTGCAA
TCTGTTCACGATCTTCCAGAAGGACATGGTCAAACTATATTCACTGCAACTACAGCCATTGTTGTTCTGACGGTGTTGCT
GATTGGAGGATCGACTGGTACAATGCTAGAAGCCCTAGAGGTTGTAGGTGATAGCCACGATACATCCTTAGGTGATGGAT
TTGAGGTGGTGAACAGTCGTTATATGACTAGTTATGATGATGAAGATACACCGCCAGGAAGTGGATTCAGGACAAAACTA
AGAGAGTTCCATAAGAGTGCGGCATCATTCACAGAACTAGATAGGAATTACCTAACACCGTTCTTCACAAGTAACAACGG
AGATTATGATGATGAGGGTAACATGGAGCAACACCATGAAGAACGAATCCCATTTACTAGAAGAGGAAATCTAAATAACC
GCGGCTAA