Details for Arabidopsis Locus AT1G79580

Position : Chr1 ( 5`- 29940850 .. 29943602 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G79580

Protein [Map View]
MEIGSSSTVAGGGQLSVPPGFRFHPTEEELLYYYLKKKVSYEPIDLDVIREVDLNKLEPWELKEKCRIGSGPQNEWYFFS
HKDKKYPTGTRTNRATAAGFWKATGRDKSIHLNSSKKIGLRKTLVFYTGRAPHGQKTEWIMHEYRLDDSENEIQEDGWVV
CRVFKKKNHFRGFHQEQEQDHHHHHQYISTNNDHDHHHHIDSNSNNHSPLILHPLDHHHHHHHIGRQIHMPLHEFANTLS
HGSMHLPQLFSPDSAAAAAAAAASAQPFVSPINTTDIECSQNLLRLTSNNNYGGDWSFLDKLLTTGNMNQQQQQQVQNHQ
AKCFGDLSNNDNNDQADHLGNNNGGSSSSPVNQRFPFHYLGNDANLLKFPK*

DNA
ATGGAGATAGGGTCGTCATCCACGGTGGCTGGCGGAGGACAGCTTTCGGTGCCTCCGGGATTCCGGTTTCATCCAACGGA
GGAGGAGCTTCTTTACTATTACCTCAAGAAGAAGGTTTCTTATGAACCAATTGATTTAGATGTAATTAGAGAAGTTGATC
TCAACAAGCTGGAACCTTGGGAACTTAAAGAGAAATGCAGAATCGGGTCGGGTCCTCAAAACGAGTGGTATTTCTTTAGC
CACAAGGACAAGAAATATCCGACTGGGACCCGAACGAACCGGGCGACAGCAGCCGGGTTCTGGAAAGCTACTGGTAGAGA
CAAATCCATACATCTCAACAGCTCCAAGAAGATTGGACTTCGTAAGACTCTTGTCTTCTACACTGGTCGTGCTCCTCATG
GCCAAAAAACCGAATGGATCATGCACGAATATCGCTTGGACGATAGCGAAAACGAAATTCAGGAAGATGGGTGGGTTGTA
TGCAGAGTGTTCAAGAAGAAGAATCATTTCAGAGGATTTCACCAAGAACAAGAGCAAGATCATCATCATCATCACCAATA
CATAAGCACCAACAATGATCATGATCACCATCATCACATTGACTCCAATTCAAACAATCATTCTCCTTTGATCCTACATC
CTCTGGATCATCATCACCACCATCATCACATTGGACGACAAATCCACATGCCATTACATGAGTTTGCAAACACTCTGAGC
CATGGCTCAATGCATCTACCTCAGCTCTTTAGCCCTGACTCAGCTGCAGCGGCGGCTGCCGCAGCAGCATCAGCCCAACC
ATTTGTGTCGCCAATCAACACTACGGACATTGAATGTTCACAGAATCTACTGAGGTTGACTTCTAACAACAACTATGGTG
GAGACTGGTCGTTTCTGGACAAGCTTCTCACTACAGGCAACATGAATCAGCAACAGCAGCAGCAAGTGCAGAACCATCAA
GCAAAATGTTTTGGTGACTTGAGTAACAACGATAATAACGATCAGGCTGATCATTTGGGTAACAACAATGGTGGTTCTTC
TTCATCTCCAGTTAATCAAAGGTTTCCGTTTCACTACTTGGGAAACGACGCTAATCTTCTCAAGTTCCCAAAGTAG