Details for Arabidopsis Locus AT1G79550

Position : Chr1 ( 5`- 29924023 .. 29926582 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G79550

Protein [Map View]
MATKRSVGTLKEADLKGKSVFVRVDLNVPLDDNSNITDDTRIRAAVPTIKYLMGNGSRVVLCSHLGRPKGVTPKYSLKPL
VPRLSELLGVEVVMANDSIGEEVQKLVAGLPEGGVLLLENVRFYAEEEKNDPEFAKKLAALADVYVNDAFGTAHRAHAST
EGVAKFLKPSVAGFLMQKELDYLVGAVANPKKPFAAIVGGSKVSTKIGVIESLLNTVDILLLGGGMIFTFYKAQGLSVGS
SLVEEDKLDLAKSLMEKAKAKGVSLLLPTDVVIADKFAPDANSKIVPATAIPDGWMGLDIGPDSIKTFSEALDTTKTIIW
NGPMGVFEFDKFAAGTEAVAKQLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVLALDE
A*

DNA
ATGGCGACGAAGAGAAGCGTTGGAACTTTGAAGGAAGCGGATCTGAAGGGAAAGAGTGTGTTCGTGAGGGTTGATCTCAA
CGTTCCTTTGGATGATAACTCTAACATCACCGATGACACCAGGATTCGTGCCGCTGTTCCCACCATCAAGTACTTGATGG
GTAATGGATCTAGGGTTGTTCTCTGCAGTCACTTGGGCCGCCCAAAAGGTGTTACTCCTAAGTACAGCTTAAAGCCTCTT
GTGCCCAGATTGTCTGAACTTCTTGGTGTTGAGGTTGTAATGGCAAATGACTCTATTGGTGAGGAAGTCCAGAAGTTGGT
TGCAGGACTACCTGAAGGTGGTGTTTTGCTCTTGGAGAATGTGAGGTTCTACGCCGAGGAAGAGAAGAATGATCCTGAAT
TTGCAAAGAAGCTTGCTGCTCTTGCCGATGTTTACGTTAATGATGCCTTCGGAACTGCTCACAGAGCTCATGCTTCCACT
GAGGGAGTTGCCAAATTCTTGAAGCCTTCAGTTGCTGGTTTCCTCATGCAGAAGGAACTTGATTACCTTGTCGGAGCTGT
GGCAAACCCCAAGAAGCCTTTTGCTGCCATTGTTGGAGGCTCAAAGGTTTCAACAAAGATTGGTGTCATTGAGTCTCTCT
TGAACACAGTTGACATCCTCCTGCTCGGTGGAGGTATGATTTTTACTTTCTACAAGGCACAAGGACTCTCAGTCGGATCT
TCCCTTGTGGAGGAGGACAAGCTTGACTTGGCAAAGTCACTCATGGAGAAAGCAAAGGCCAAAGGTGTCTCTCTCTTGCT
CCCAACCGATGTGGTTATTGCTGACAAGTTTGCTCCCGATGCTAACAGCAAGATAGTGCCAGCCACTGCCATCCCTGATG
GCTGGATGGGTCTAGATATTGGTCCAGACTCCATCAAGACATTCAGCGAAGCTCTGGACACAACCAAAACCATCATCTGG
AATGGTCCCATGGGTGTGTTTGAATTCGATAAGTTTGCTGCTGGAACTGAGGCCGTAGCAAAGCAGCTTGCAGAACTAAG
CGGAAAGGGAGTAACCACAATCATTGGAGGAGGTGACTCTGTTGCTGCCGTCGAGAAGGTTGGTTTGGCAGACAAGATGA
GCCACATCTCTACCGGAGGCGGTGCTAGTTTGGAGCTTCTTGAGGGTAAGCCACTTCCAGGAGTCCTCGCTCTCGACGAA
GCTTGA