Details for Arabidopsis Locus AT1G79520

Position : Chr1 ( 5`- 29912251 .. 29914615 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G79520

Protein [Map View]
MAATEHRGLSGGDYNVDLLPIDQDDSPPSSWRLSLDTFRLPSSSPLSSGRHNGRTRLSRYLRTPSKFLFLVLVLNLQKER
KVSEYYKQQEKLLEGFNEMETINETGFVSGAPTEEELKKLAKSERLAVHISNAANLVLFVAKVYASVESRSMAVIASTLD
SLLDLLSGFILWFTANAMRTPNNFRYPIGKRRMQPVGIIVFASVMATLGLQVILESTRLLVSKNGSHMSSTEEKWMIGIM
ASATVVKFLLMLYCRSFQNEIVRAYAQDHLFDVITNSVGLATAVLAVKFYWWIDPSGAILIALYTISTWARTVLENVHSL
IGRSAPPDFLAKLTFLIWNHHEKIKHIDTVRAYTFGSHYFVEVDIVLPEDMRLHEAHNIGETLQEKLEQLSEVERAFVHI
DFEFTHRPEHKCKV*

DNA
ATGGCGGCGACGGAGCATCGCGGCCTCAGTGGAGGAGACTACAATGTCGACCTTTTACCAATTGACCAAGACGATTCGCC
ACCATCTTCATGGCGTCTCAGCCTCGACACATTCCGTCTCCCTTCTTCTTCACCGTTATCATCAGGACGTCACAACGGCC
GTACTCGCTTGTCTCGTTATCTCCGGACTCCGAGTAAGTTTCTCTTCCTCGTCCTTGTCTTAAATCTCCAAAAGGAACGC
AAAGTCTCAGAGTACTACAAACAGCAAGAGAAGCTTCTGGAGGGTTTCAATGAGATGGAGACAATTAACGAAACTGGTTT
TGTATCTGGAGCTCCAACTGAGGAAGAACTGAAGAAGCTTGCAAAGAGCGAGAGGCTTGCAGTTCACATCTCAAACGCAG
CAAACCTTGTGCTTTTTGTAGCAAAAGTTTATGCTTCTGTGGAGAGTAGGTCTATGGCTGTCATTGCTTCCACTTTGGAC
TCTCTCTTAGATCTCTTGTCTGGATTTATTCTATGGTTTACTGCTAATGCCATGAGAACACCTAACAATTTTCGCTATCC
AATTGGAAAACGACGGATGCAACCTGTGGGAATCATTGTGTTTGCATCTGTGATGGCAACTCTTGGACTACAAGTGATAC
TAGAGTCAACTAGGCTACTTGTTTCCAAGAATGGTTCTCATATGAGTAGCACCGAGGAAAAATGGATGATTGGAATAATG
GCTTCAGCTACAGTCGTCAAGTTTCTGCTCATGCTTTACTGCAGGAGTTTCCAGAACGAAATTGTCAGGGCCTATGCACA
AGATCACCTCTTTGATGTTATCACCAATTCAGTCGGTTTAGCAACCGCTGTTTTAGCTGTAAAATTCTACTGGTGGATTG
ATCCCTCTGGGGCTATACTAATTGCCCTGTATACAATCAGCACATGGGCAAGAACAGTTCTAGAGAATGTCCATTCACTG
ATAGGACGCTCAGCACCACCAGATTTCTTGGCGAAACTAACGTTCTTGATTTGGAACCATCACGAGAAGATAAAACACAT
AGACACAGTGAGAGCCTACACGTTTGGGTCACACTACTTTGTGGAAGTTGACATTGTGTTGCCAGAGGACATGAGGCTGC
ATGAAGCTCACAACATAGGAGAAACTCTTCAGGAGAAGCTGGAGCAACTCTCTGAGGTTGAGAGAGCTTTTGTCCATATT
GACTTTGAGTTTACTCATCGTCCAGAACACAAATGCAAGGTTTGA