Details for Arabidopsis Locus AT1G79480

Position : Chr1 ( 5`- 29897727 .. 29899604 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G79480

Protein [Map View]
MESYRVFTTICLLLCLFLSANFFTHYVVDARKSVGFEREPKKVMMIKALKHTSLLQKMMTQLNLAQPLDYSSSSNTQPYG
VSTTLTLPPYVSLPPLSVPGNAPPFCINPPNTPPSSSYPGLSPPPGPITLPNPPDSSSNPNSNPNPPESSSNPNPPDSSS
NPNSNPNPPVTVPNPPESSSNPNPPDSSSNPNSNPNPPESSSNPNPPVTVPNPPESSSNPNPPESSSNPNPPITIPYPPE
SSSPNPPEIVPSPPESGYTPGPVLGPPYSEPGPSTPTGSIPSPSSGFLPPIVYPPPMAPPSPSVTPTSAYWCVAKPSVPD
PIIQEAMNFACGSGADCHSIQPNGPCFKPNTLWAHASFAYNSYWQRTKSTGGSCTFGGTGMLVTVDPSFNGCHFDFF*

DNA
ATGGAATCATATCGAGTCTTCACAACTATTTGTCTTCTTCTTTGTCTCTTTCTCTCAGCCAACTTCTTCACTCATTATGT
AGTAGATGCAAGAAAAAGCGTGGGATTTGAGAGAGAGCCAAAGAAGGTGATGATGATCAAAGCATTAAAGCACACATCAT
TGTTACAGAAAATGATGACACAGCTCAATCTTGCTCAGCCTTTAGACTACTCTTCATCCTCCAACACTCAACCTTATGGC
GTTAGCACAACTCTCACTCTACCTCCTTATGTTTCACTTCCCCCACTTTCAGTTCCCGGAAATGCCCCTCCTTTTTGCAT
TAATCCCCCAAATACTCCTCCTTCCTCCTCTTATCCTGGTCTTAGCCCACCTCCCGGCCCAATCACATTACCTAACCCAC
CCGACTCCTCCTCTAACCCGAACTCCAACCCCAACCCACCCGAATCATCCTCTAACCCGAACCCACCTGATTCATCCTCT
AATCCAAACTCAAACCCAAACCCACCCGTTACCGTCCCTAATCCACCCGAATCATCCTCTAACCCAAACCCACCTGATTC
ATCCTCTAATCCAAACTCAAACCCAAACCCACCCGAATCATCCTCTAACCCAAACCCACCCGTTACCGTCCCTAACCCAC
CCGAATCATCCTCTAACCCAAACCCACCAGAGTCATCCTCTAATCCAAACCCACCCATTACCATTCCATACCCGCCTGAA
TCCTCCAGCCCAAACCCGCCAGAAATAGTTCCTAGCCCTCCAGAATCTGGTTATACACCAGGGCCCGTTTTAGGCCCACC
TTACTCTGAACCGGGCCCATCAACACCTACCGGATCAATTCCAAGTCCATCATCGGGGTTTCTTCCCCCAATCGTTTATC
CGCCACCCATGGCACCACCGTCACCGAGCGTAACTCCGACGTCGGCTTACTGGTGCGTAGCTAAGCCCTCGGTCCCTGAC
CCAATTATTCAAGAAGCCATGAACTTTGCATGTGGGTCAGGAGCTGATTGTCATTCAATTCAGCCTAACGGGCCTTGCTT
TAAGCCTAATACATTGTGGGCCCATGCTTCGTTCGCCTACAATAGCTATTGGCAACGGACCAAAAGTACGGGTGGCTCGT
GCACGTTCGGCGGCACTGGCATGCTTGTCACCGTTGATCCAAGCTTTAACGGGTGCCATTTTGATTTCTTCTGA