Details for Arabidopsis Locus AT1G79470

Position : Chr1 ( 5`- 29894598 .. 29897166 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G79470

Protein [Map View]
MSTLEDGFPADKLFAQGYSYTYDDVIFLPHFIDFSTDAVSLSTRLSRRVPLSIPCVSSPMDTVSESHMAAAMASLGGIGI
VHYNCGIAAQASIIRQAKSLKHPIASDAGVKFPEYEITSLDAFGPSSFVFVEQTGTMTTPKLLGYVTKSQWKRMNYEQRE
MKIYDYMKSCDSSDYCVPWEIDFEKLEFVLEDKQKGFVVLERDGETVNVVTKDDIQRVKGYPKSGPGTVGPDGEWMVGAA
IGTRESDKERLEHLVNVGVNAVVLDSSQGNSIYQLEMIKYVKKTYPELDVIGGNVVTMYQAQNLIQAGVDGLRVGMGSGS
ICTTQEVCAVGRGQATAVYKVCSIAAQSGIPVIADGGISNSGHIVKALVLGASTVMMGSFLAGSTEAPGGYEYTNGKRIK
KYRGMGSLEAMTKGSDQRYLGDQTKLKIAQGVVGAVADKGSVLKLIPYTMHAVKQGFQDLGASSLQSAHGLLRSNILRLE
ARTGAAQVEGGVHGLVSYEKKSF*

DNA
ATGTCGACACTCGAGGATGGATTTCCGGCGGATAAGCTCTTCGCTCAAGGATACTCTTACACCTACGACGACGTCATCTT
TCTTCCTCACTTCATCGATTTCTCCACAGACGCTGTTTCTCTATCCACGCGCCTTAGCCGGCGCGTGCCTCTCTCCATAC
CTTGCGTTTCGTCTCCGATGGATACTGTTTCGGAATCTCACATGGCTGCTGCTATGGCTTCTCTTGGTGGGATTGGAATC
GTCCACTATAACTGTGGCATCGCCGCTCAAGCATCGATTATTCGCCAAGCTAAGTCGCTTAAACATCCGATTGCTTCCGA
CGCCGGTGTGAAGTTCCCGGAGTATGAGATTACTTCTTTAGATGCTTTTGGTCCTTCTTCCTTCGTTTTTGTCGAGCAAA
CAGGAACAATGACGACTCCTAAATTGTTAGGCTATGTAACGAAATCGCAGTGGAAGAGAATGAATTACGAACAAAGGGAG
ATGAAGATATACGATTACATGAAGAGCTGTGATAGCAGTGACTATTGTGTACCATGGGAAATTGATTTTGAAAAGTTGGA
GTTTGTTTTAGAAGATAAGCAAAAGGGCTTTGTGGTTCTTGAGAGGGATGGTGAGACTGTGAACGTGGTGACGAAAGATG
ATATACAGAGGGTTAAAGGATATCCCAAGTCTGGACCAGGGACTGTGGGCCCAGACGGTGAGTGGATGGTTGGTGCAGCG
ATAGGTACGAGGGAGTCTGATAAGGAGAGGCTTGAGCATTTGGTTAATGTTGGGGTCAATGCTGTAGTGTTGGATAGTTC
GCAAGGGAACTCTATTTACCAGCTTGAGATGATCAAGTATGTGAAAAAGACTTACCCTGAATTGGATGTGATTGGTGGCA
ATGTTGTGACAATGTACCAGGCACAGAATTTGATCCAAGCAGGAGTTGATGGGTTGAGAGTTGGTATGGGATCTGGTTCG
ATATGTACCACACAAGAGGTTTGTGCAGTTGGTCGTGGACAGGCTACTGCTGTGTACAAGGTTTGTTCGATCGCTGCTCA
GAGCGGGATTCCAGTTATAGCGGATGGTGGTATCTCAAATTCAGGGCACATTGTAAAGGCTCTCGTCCTTGGAGCATCAA
CTGTTATGATGGGTAGCTTTTTAGCTGGAAGTACTGAGGCTCCCGGGGGTTACGAGTATACGAACGGTAAGAGGATCAAG
AAGTACCGTGGAATGGGATCGCTAGAAGCAATGACTAAAGGAAGTGACCAAAGATACTTAGGAGATCAAACAAAACTCAA
GATTGCTCAAGGAGTGGTTGGAGCAGTCGCGGATAAAGGCTCAGTGTTGAAGCTGATACCTTACACAATGCACGCCGTGA
AACAAGGTTTCCAAGACCTTGGTGCTTCTTCCTTGCAATCTGCTCATGGTCTGTTGAGATCAAACATCCTTAGGCTTGAG
GCTCGAACTGGTGCTGCACAGGTCGAAGGAGGAGTTCACGGGCTGGTTTCTTATGAAAAGAAATCGTTTTAA