Details for Arabidopsis Locus AT1G79460

Position : Chr1 ( 5`- 29890392 .. 29894587 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G79460

Protein [Map View]
MSINLRSSGCSSPISATLERRLDSEVQTRANNVSFEQTKEKIRKMLEKVELSVSAYDTSWVAMVPSPSSQNAPLFPQCVK
WLLDNQHEDGSWGLDNHDHQSLKKDVLSSTLASILALKKWGIGERQINKGLQFIELNSALVTDETIQKPTGFDIIFPGMI
KYARDLNLTIPLGSEVVDDMIRKRDLDLKCDSEKFSKGREAYLAYVLEGTRNLKDWDLIVKYQRKNGSLFDSPATTAAAF
TQFGNDGCLRYLCSLLQKFEAAVPSVYPFDQYARLSIIVTLESLGIDRDFKTEIKSILDETYRYWLRGDEEICLDLATCA
LAFRLLLAHGYDVSYDPLKPFAEESGFSDTLEGYVKNTFSVLELFKAAQSYPHESALKKQCCWTKQYLEMELSSWVKTSV
RDKYLKKEVEDALAFPSYASLERSDHRRKILNGSAVENTRVTKTSYRLHNICTSDILKLAVDDFNFCQSIHREEMERLDR
WIVENRLQELKFARQKLAYCYFSGAATLFSPELSDARISWAKGGVLTTVVDDFFDVGGSKEELENLIHLVEKWDLNGVPE
YSSEHVEIIFSVLRDTILETGDKAFTYQGRNVTHHIVKIWLDLLKSMLREAEWSSDKSTPSLEDYMENAYISFALGPIVL
PATYLIGPPLPEKTVDSHQYNQLYKLVSTMGRLLNDIQGFKRESAEGKLNAVSLHMKHERDNRSKEVIIESMKGLAERKR
EELHKLVLEEKGSVVPRECKEAFLKMSKVLNLFYRKDDGFTSNDLMSLVKSVIYEPVSLQEESLT*

DNA
ATGTCTATCAACCTTCGCTCCTCCGGTTGTTCGTCTCCGATCTCAGCTACTTTGGAACGGAGATTGGACTCAGAAGTACA
GACAAGAGCTAACAATGTGAGCTTTGAGCAAACAAAGGAGAAGATTAGGAAGATGTTGGAGAAAGTGGAGCTTTCTGTTT
CGGCCTACGATACTAGTTGGGTAGCAATGGTTCCATCACCGAGCTCCCAAAATGCTCCACTTTTCCCACAGTGTGTGAAA
TGGTTATTGGATAATCAACATGAAGATGGATCTTGGGGACTTGATAACCATGACCATCAATCTCTTAAGAAGGATGTGTT
ATCATCTACACTGGCTAGTATCCTCGCGTTAAAGAAGTGGGGAATTGGTGAAAGACAAATAAACAAGGGTCTCCAGTTTA
TTGAGCTGAATTCTGCATTAGTCACTGATGAAACCATACAGAAACCAACAGGGTTTGATATTATATTTCCTGGGATGATT
AAATATGCTAGAGATTTGAATCTGACGATTCCATTGGGCTCAGAAGTGGTGGATGACATGATACGAAAAAGAGATCTGGA
TCTTAAATGTGATAGTGAAAAGTTTTCAAAGGGAAGAGAAGCATATCTGGCCTATGTTTTAGAGGGGACAAGAAACCTAA
AAGATTGGGATTTGATAGTCAAATATCAAAGGAAAAATGGGTCACTGTTTGATTCTCCAGCCACAACAGCAGCTGCTTTT
ACTCAGTTTGGGAATGATGGTTGTCTCCGTTATCTCTGTTCTCTCCTTCAGAAATTCGAGGCTGCAGTTCCTTCAGTTTA
TCCATTTGATCAATATGCACGCCTTAGTATAATTGTCACTCTTGAAAGCTTAGGAATTGATAGAGATTTCAAAACCGAAA
TCAAAAGCATATTGGATGAAACCTATAGATATTGGCTTCGTGGGGATGAAGAAATATGTTTGGACTTGGCCACTTGTGCT
TTGGCTTTTCGATTATTGCTTGCTCATGGCTATGATGTGTCTTACGATCCGCTAAAACCATTTGCAGAAGAATCTGGTTT
CTCTGATACTTTGGAAGGATATGTTAAGAATACGTTTTCTGTGTTAGAATTATTTAAGGCTGCTCAAAGTTATCCACATG
AATCAGCTTTGAAGAAGCAGTGTTGTTGGACTAAACAATATCTGGAGATGGAATTGTCCAGCTGGGTTAAGACCTCTGTT
CGAGATAAATACCTCAAGAAAGAGGTCGAGGATGCTCTTGCTTTTCCCTCCTATGCAAGCCTAGAAAGATCAGATCACAG
GAGAAAAATACTCAATGGTTCTGCTGTGGAAAACACCAGAGTTACAAAAACCTCATATCGTTTGCACAATATTTGCACCT
CTGATATCCTGAAGTTAGCTGTGGATGACTTCAATTTCTGCCAGTCCATACACCGTGAAGAAATGGAACGTCTTGATAGG
TGGATTGTGGAGAATAGATTGCAGGAACTGAAATTTGCCAGACAGAAGCTGGCTTACTGTTATTTCTCTGGGGCTGCAAC
TTTATTTTCTCCTGAACTATCTGATGCTCGTATATCGTGGGCCAAAGGTGGAGTACTTACAACGGTTGTAGACGACTTCT
TTGATGTTGGAGGGTCCAAAGAAGAACTGGAAAACCTCATACACTTGGTCGAAAAGTGGGATTTGAACGGTGTTCCTGAG
TACAGCTCAGAACATGTTGAGATCATATTCTCAGTTCTAAGGGACACCATTCTCGAAACAGGAGACAAAGCATTCACCTA
TCAAGGACGCAATGTGACACACCACATTGTGAAAATTTGGTTGGATCTGCTCAAGTCTATGTTGAGAGAAGCCGAGTGGT
CCAGTGACAAGTCAACACCAAGCTTGGAGGATTACATGGAAAATGCGTACATATCATTTGCATTAGGACCAATTGTCCTC
CCAGCTACCTATCTGATCGGACCTCCACTTCCAGAGAAGACAGTCGATAGCCACCAATATAATCAGCTCTACAAGCTCGT
GAGCACTATGGGTCGTCTTCTAAATGACATACAAGGTTTTAAGAGAGAAAGCGCGGAAGGGAAGCTGAATGCGGTTTCAT
TGCACATGAAACACGAGAGAGACAATCGCAGCAAAGAAGTGATCATAGAATCGATGAAAGGTTTAGCAGAGAGAAAGAGG
GAAGAATTGCATAAGCTAGTTTTGGAGGAGAAAGGAAGTGTGGTTCCAAGGGAATGCAAAGAAGCGTTCTTGAAAATGAG
CAAAGTGTTGAACTTATTTTACAGGAAGGACGATGGATTCACATCAAATGATCTGATGAGTCTTGTTAAATCAGTGATCT
ACGAGCCTGTTAGCTTACAGGAAGAATCTTTAACTTGA