Details for Arabidopsis Locus AT1G79430

Position : Chr1 ( 5`- 29877228 .. 29879206 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G79430

Protein [Map View]
MFHAKKPSSMNGSYENRAMCVQGDSGLVLTTDPKPRLRWTVELHERFVDAVAQLGGPDKATPKTIMRVMGVKGLTLYHLK
SHLQKFRLGKQPHKEYGDHSTKEGSRASAMDIQRNVASSSGMMSRNMNEMQMEVQRRLHEQLEVQRHLQLRIEAQGKYMQ
SILERACQTLAGENMAAATAAAAVGGGYKGNLGSSSLSAAVGPPPHPLSFPPFQDLNIYGNTTDQVLDHHNFHHQNIENH
FTGNNAADTNIYLGKKRPNPNFGNDVRKGLLMWSDQDHDLSANQSIDDEHRIQIQMATHVSTDLDSLSEIYERKSGLSGD
EGNNGGKLLERPSPRRSPLSPMMNPNGGLIQGRNSPFG*

DNA
ATGTTCCATGCTAAGAAACCTTCAAGTATGAATGGTTCATATGAGAACAGAGCTATGTGCGTTCAAGGCGATTCAGGCCT
TGTCCTCACCACCGACCCTAAACCGCGTTTGCGTTGGACCGTCGAACTCCACGAGCGTTTTGTGGACGCCGTCGCTCAGC
TCGGCGGCCCCGACAAAGCGACCCCAAAGACGATTATGAGAGTTATGGGTGTGAAGGGTCTTACTCTTTACCACCTAAAG
AGCCATCTTCAGAAATTCAGGCTTGGAAAGCAGCCGCACAAGGAGTACGGAGATCACTCCACAAAGGAAGGTTCAAGAGC
TTCTGCCATGGATATTCAGCGCAACGTAGCTTCTTCTTCTGGCATGATGAGTCGCAACATGAATGAGATGCAAATGGAAG
TGCAGAGAAGGTTGCATGAACAGCTAGAGGTGCAAAGACATCTGCAACTGAGGATTGAAGCACAAGGAAAGTACATGCAA
TCTATCTTGGAGAGAGCTTGCCAAACCCTAGCCGGTGAGAACATGGCAGCCGCCACCGCAGCAGCCGCCGTCGGAGGAGG
ATACAAGGGTAATCTGGGAAGTTCGAGTCTTTCAGCAGCGGTGGGCCCACCTCCTCATCCTCTTAGTTTCCCGCCGTTTC
AAGACCTAAACATCTATGGAAACACAACCGACCAAGTCCTCGACCATCACAACTTCCATCATCAAAACATAGAGAACCAT
TTCACGGGTAACAATGCTGCAGACACCAACATTTACTTGGGGAAGAAGCGACCTAATCCTAATTTTGGTAACGATGTAAG
GAAAGGACTATTGATGTGGTCTGATCAAGATCACGATCTTTCCGCAAACCAATCGATCGATGATGAGCATAGAATTCAGA
TACAGATGGCTACACATGTCTCCACGGATTTGGATTCTTTGTCGGAGATCTACGAAAGGAAATCAGGTTTATCAGGTGAT
GAAGGGAATAATGGTGGGAAATTACTGGAAAGGCCATCGCCTAGGAGATCACCATTGAGTCCTATGATGAACCCTAATGG
TGGATTAATACAAGGAAGAAACTCGCCATTTGGGTGA