Details for Arabidopsis Locus AT1G79420

Position : Chr1 ( 5`- 29871458 .. 29874315 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G79420

Protein [Map View]
MSNSKSYWRKQRWGTPPQALTPLMEGPDPDMQDERTKKESSWEAIREWFKVHKGISGNMSSPSVQPLCNSYDVPAKGQDL
RLLLGVLGCPLAPISVVVSDLFPDDPLLGSFQIKNVPFETSTAHYIIQQYLAATGCLKRAKAAKNMYATGIMKMSCCETE
IAAGKSVKTLGGGGNGRSGDSGCFVLWQMQPGMWSLELVLGGTKLISGSDGKTVWRHTPWLGTHAAKGPQRPLRRLIQGL
DPKTTASLFAKAQCLGERRIGDDDCFVLKVSADRDSLLERNDAGAPAEVIRHALYGYFCQKSGLLVYLEDSHLTRVMTIS
PEDEAVYWETTIGTSIGDYRDVDGVAVAHCGRAVATVFRFGETSLQYSRTRMEEIWRIDDVVFDVPGLSLDSFIPPADIF
EDTNPNNNNIYSIVNSR*

DNA
ATGAGCAACTCAAAGTCATACTGGAGAAAGCAAAGATGGGGAACGCCGCCACAAGCCCTAACACCGTTAATGGAAGGACC
AGATCCAGACATGCAAGACGAAAGAACCAAGAAGGAGAGCTCATGGGAAGCAATTAGAGAATGGTTTAAGGTTCATAAGG
GCATTTCTGGAAATATGTCATCTCCTTCGGTCCAACCACTTTGCAACAGCTATGACGTGCCAGCTAAGGGACAAGACTTG
AGGCTCTTGCTCGGCGTCTTGGGTTGTCCTCTTGCTCCAATCTCCGTTGTCGTCTCTGACCTATTTCCCGATGACCCTCT
TCTTGGTTCTTTCCAAATCAAGAATGTCCCATTTGAGACGTCGACAGCGCATTATATAATACAACAATACTTAGCGGCGA
CGGGATGTCTAAAGCGAGCGAAGGCGGCGAAAAACATGTACGCGACGGGGATAATGAAAATGAGTTGCTGTGAGACGGAG
ATAGCCGCCGGAAAAAGTGTGAAGACACTAGGCGGTGGTGGAAACGGTAGGAGCGGAGATAGTGGTTGCTTCGTGCTGTG
GCAGATGCAGCCTGGAATGTGGTCTCTGGAGCTTGTTCTCGGTGGAACTAAACTCATCTCTGGCTCGGACGGTAAAACAG
TTTGGCGCCATACGCCATGGCTCGGTACTCACGCCGCTAAAGGCCCTCAACGTCCACTTCGTCGTCTAATCCAGGGCTTG
GACCCAAAAACCACAGCAAGCCTATTCGCAAAGGCCCAATGCTTAGGCGAACGAAGAATCGGCGACGATGACTGTTTCGT
GCTCAAAGTCTCCGCCGATCGTGACTCGTTGTTAGAACGGAATGACGCCGGAGCTCCGGCGGAGGTTATACGCCACGCAC
TGTACGGATACTTCTGTCAGAAAAGCGGTCTATTAGTCTATTTAGAGGATTCGCACCTCACTAGGGTTATGACGATCTCG
CCTGAGGACGAGGCGGTTTACTGGGAGACGACGATCGGAACAAGCATCGGAGATTACCGTGACGTTGACGGAGTAGCCGT
CGCGCATTGTGGTCGTGCCGTCGCGACGGTGTTCCGATTTGGGGAGACGTCGTTGCAGTATAGCAGAACGAGGATGGAGG
AGATTTGGAGGATAGACGACGTCGTTTTCGATGTGCCTGGTCTCTCTTTGGACTCCTTTATTCCTCCCGCCGATATATTT
GAAGATACTAACCCTAACAATAATAATATTTACAGTATTGTTAATTCCCGATGA