Details for Arabidopsis Locus AT1G79380

Position : Chr1 ( 5`- 29860491 .. 29863316 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G79380

Protein [Map View]
MTMGNFLKRFGSGKSRSSRNMTLGTTSSQSHEPSPSDPSLSLADNTNATKKKYALIPDRFSSLDQVSKALREAGLESSNL
ILGVDFTKSNEWTGKTSFDGKCLHALGETSNPYEKAIFVIGQTLAPFDEDNLIPCFGFGDSTTHDEEVFGFHSDNSPCHG
FEEVLACYKRIAPNLRLSGPTSYGPLIDAAVDIVEKNNGQFHVLVIVADGQVTRGTDMAEGELSQQEKTTIDAIVNASSY
ALSIVLVGVGDGPWEDMRKFDDKIPKREFDNFQFVNFTEIMTRNSPESAKETAFALAALMEIPFQYQAAIELRLLGKQTG
LAKTIVPRPPPIPYTPPTNAELPSTASPASPEQTQSCPICLTNRKDVAFSCGHMTCGDCGSKISNCPICRVRITNRLKLY
T*

DNA
ATGACTATGGGGAATTTCTTAAAGAGATTTGGAAGTGGAAAAAGCAGAAGCAGTAGAAATATGACTCTGGGAACGACGTC
GTCTCAATCTCATGAACCATCACCGTCGGATCCTTCACTCTCCCTTGCCGATAATACCAACGCCACCAAGAAGAAGTACG
CTCTCATCCCTGACCGCTTCTCTTCCCTCGACCAGGTATCAAAAGCTCTAAGAGAAGCTGGTCTTGAATCATCCAATCTC
ATTCTCGGAGTTGATTTCACAAAGAGCAACGAGTGGACTGGGAAAACTTCTTTCGATGGAAAATGTCTGCACGCGCTCGG
CGAAACTTCGAATCCATATGAAAAGGCGATTTTTGTAATCGGCCAAACGTTGGCTCCTTTTGATGAAGACAATCTCATCC
CTTGTTTCGGCTTTGGCGATTCAACAACTCATGACGAGGAAGTGTTCGGTTTCCATAGCGACAATTCTCCATGTCATGGC
TTCGAAGAGGTCTTAGCATGTTACAAGAGAATTGCACCCAACTTGCGTCTATCAGGGCCAACGTCGTATGGACCGCTCAT
CGATGCTGCTGTCGACATTGTGGAGAAGAACAACGGACAATTCCATGTTCTGGTGATTGTTGCAGATGGACAGGTAACGA
GAGGTACGGATATGGCCGAGGGAGAACTCAGTCAACAAGAGAAAACAACCATCGACGCGATTGTAAATGCAAGCTCGTAT
GCTTTGTCGATTGTTTTAGTCGGTGTTGGAGACGGACCATGGGAAGACATGAGGAAGTTCGATGATAAGATCCCTAAGCG
TGAATTCGACAACTTTCAGTTTGTGAATTTCACAGAGATTATGACGAGAAACTCACCAGAGTCTGCCAAAGAAACTGCTT
TTGCTCTAGCTGCTCTAATGGAGATTCCCTTTCAGTATCAAGCAGCCATCGAACTCCGCTTACTCGGGAAGCAGACGGGC
TTAGCGAAGACAATAGTTCCGAGGCCACCACCAATTCCGTACACACCTCCAACTAATGCTGAACTACCATCAACTGCATC
ACCTGCATCACCTGAACAAACCCAGAGTTGCCCGATTTGTCTGACTAACCGAAAAGACGTGGCTTTCAGCTGTGGCCACA
TGACTTGTGGAGATTGCGGATCCAAAATATCAAATTGCCCGATCTGTCGAGTAAGGATCACGAACCGGCTAAAGCTTTAC
ACATGA