Details for Arabidopsis Locus AT1G79360

Position : Chr1 ( 5`- 29854038 .. 29855821 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G79360

Protein [Map View]
MAEPTQPLLTDSNSSSPRSLDDTIESYIGSFGWAQFLQAALVSFSGVFDAQQTFISVFTDSEPTWHCTDSNSICHESISN
ICILPKTAWSWDYSPHVSVISEWGLQCAGSFVKGLPESSFFVGCLIGGLVLSTLADSSLGRKNMLFLSCLVMAISTMLTV
FSPNIWVYAVLRFVNGFGRATIGTCALVLSTELVGKKWRGRVGIMSFFGFMLGFLSLPLMAYMNRGSSWRILYAWTSIPT
IIYCVLVRFFVCESPRWLFVRGRREEAISILKRVASIPSTDVSSGGAISMSFSSLPFEEDEEKPSTNVNIFTTMKVLVEK
RWALKRLSAVMAIAFGIGLVYYGMPLALSNLDFNIYLSAAFNALMDLPANLITLFLVDKLSRRNALIGFTALGGVSSVLI
FALHNMRIGNHGALQLALELISYFSACSAFNMEMIYTIELFPTCVRNSAIAMARQALVLGGVFSPIMVAAGRKNAFWSFG
LFGLAIGLLGLFAVGLPETRGSDLCDTMDEEECKDRRSKVAVNNVIA*

DNA
ATGGCAGAACCAACTCAGCCGCTTCTGACCGATTCCAACTCGTCATCACCGAGATCTCTCGACGACACAATCGAGAGTTA
CATTGGAAGCTTTGGGTGGGCTCAGTTTCTTCAAGCGGCTTTAGTCTCATTCTCCGGTGTTTTCGACGCTCAACAAACTT
TCATCTCTGTGTTTACAGACTCCGAACCCACGTGGCACTGCACCGACTCGAACTCGATCTGCCATGAATCCATCTCCAAC
ATCTGTATCCTCCCCAAAACCGCATGGTCTTGGGATTACTCTCCTCACGTCTCTGTTATATCCGAATGGGGTCTCCAATG
CGCCGGCTCTTTCGTCAAGGGCTTACCGGAGAGTTCTTTCTTCGTCGGATGTTTAATCGGAGGTTTGGTTCTCTCAACAC
TTGCTGATTCTTCCTTGGGTCGTAAAAACATGTTGTTTCTGTCCTGTCTCGTTATGGCGATATCAACGATGCTAACGGTT
TTCTCACCAAACATTTGGGTTTACGCTGTTCTTCGATTCGTTAATGGATTTGGTCGAGCGACGATAGGGACATGTGCGCT
CGTTCTTTCGACGGAATTAGTTGGGAAGAAATGGCGAGGACGAGTAGGGATAATGAGTTTCTTCGGATTCATGCTTGGCT
TTTTGTCTCTTCCTTTGATGGCTTACATGAACAGAGGAAGTTCTTGGAGGATTCTCTACGCATGGACTTCGATTCCAACG
ATAATATACTGCGTTCTTGTTCGGTTTTTCGTTTGTGAGTCTCCAAGGTGGCTTTTCGTTAGAGGCCGTAGAGAAGAAGC
TATTTCGATTCTCAAAAGGGTTGCTTCGATTCCGTCTACTGATGTAAGCAGTGGTGGTGCAATATCTATGAGTTTTTCGA
GCTTACCTTTTGAAGAAGATGAAGAGAAGCCTAGTACTAATGTTAACATCTTCACGACCATGAAGGTGTTGGTAGAGAAA
AGATGGGCGCTTAAGAGATTATCCGCGGTAATGGCCATTGCGTTCGGGATTGGTTTGGTCTATTACGGGATGCCTTTAGC
GTTATCGAATCTTGATTTCAACATCTATTTAAGTGCAGCGTTTAATGCGTTGATGGATTTACCAGCGAACCTCATCACGC
TTTTCCTAGTCGATAAACTCAGTAGGAGAAACGCGCTTATCGGATTTACGGCTTTAGGTGGAGTCTCTAGCGTTCTCATA
TTTGCGTTACATAATATGAGAATTGGAAACCACGGGGCGTTACAGTTGGCGTTAGAGCTAATCTCTTACTTTAGCGCGTG
TTCGGCTTTTAACATGGAGATGATATACACGATCGAGCTGTTTCCGACATGTGTGAGAAACTCGGCTATCGCAATGGCTA
GACAGGCTTTGGTGCTTGGTGGAGTTTTCAGCCCTATTATGGTAGCAGCTGGTCGGAAAAACGCGTTCTGGTCGTTCGGA
TTGTTTGGTCTTGCTATAGGTTTGTTGGGATTGTTTGCAGTTGGATTGCCAGAGACTAGAGGGAGTGATCTATGTGACAC
TATGGACGAGGAAGAGTGCAAAGACCGGCGGAGTAAAGTCGCCGTTAATAATGTCATTGCATGA